The domain within your query sequence starts at position 5 and ends at position 169; the E-value for the p25-alpha domain shown below is 5.9e-57.
AERTFHRFAVFGESSSSSKEITNKNFSKLCKDCDIMDGKAVTSTDVDIVFSKVKAKNART INFQQFQEAMKELGQKRFKGKNPDEALQGVFKLMEGKDPATTGVTKSTTVGGVDRLTDTS KYTGTHKERFDESGKGKGIEGREETTDNSGYVSGYKGAGTYDKKN
p25-alpha |
![]() |
---|
PFAM accession number: | PF05517 |
---|---|
Interpro abstract (IPR008907): | This family includes a 25kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [ (PUBMED:1909972) ]. In mammals, the protein appears to be brain specific. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry p25-alpha