The domain within your query sequence starts at position 113 and ends at position 155; the E-value for the pKID domain shown below is 1.2e-23.
ESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEK
pKID |
 |
|---|
| PFAM accession number: | PF02173 |
|---|---|
| Interpro abstract (IPR003102): | The nuclear factor CREB activates transcription of target genes in part through direct interactions with the KIX domain of the coactivator CBP in a phosphorylation-dependent manner. CBP and P300 bind to the pKID (phosphorylated kinase-inducible-domain) domain of CREB [ (PUBMED:9413984) ]. |
| GO process: | regulation of transcription, DNA-templated (GO:0006355) |
| GO function: | protein binding (GO:0005515) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry pKID