The domain within your query sequence starts at position 555 and ends at position 623; the E-value for the tRNA-synt_1_2 domain shown below is 1.1e-12.

YQHLKGKCVVHPFLSRSLPIVFDDFVDMEFGTGAVKITPAHDQNDYEVGQRHRLEAISIM
DSKGALINV

tRNA-synt_1_2

tRNA-synt_1_2
PFAM accession number:PF13603
Interpro abstract (IPR025709):

This entry represents the editing domain (known as CP1 domain) of Leucyl-tRNA synthetase ( EC 6.1.1.4 ), which hydrolyses mischarged tRNALeu. In the case of Leucyl-tRNA synthetase, the beta-strands that link the CP1 domain to the aminoacylation core of the protein are also required for editing activity [ (PUBMED:17474713) ].

GO process:tRNA aminoacylation for protein translation (GO:0006418)
GO function:aminoacyl-tRNA editing activity (GO:0002161)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry tRNA-synt_1_2