The domain within your query sequence starts at position 26 and ends at position 155; the E-value for the tRNA_edit domain shown below is 9.6e-30.

HPEVFTIEEMMPHIQHLKGAHSKNLFLKDKKKKNYWLVTVLHDRQINLNDLGKQLGVGSG
NLRFADETAMLEKLKVGQGCATPLSLFCDDGDVKFVLDSAFLEGGHEKVYFHPMTNAATM
GLSPEDFLIF

tRNA_edit

• PFAM accession number: PF04073
• Interpro abstract (IPR007214):

  Bacterial prolyl-tRNA synthetases and some smaller paralogues, YbaK and ProX, can hydrolyse misacylated Cys-tRNA(Pro) or Ala-tRNA(Pro) [ (PUBMED:15886196) ]. The small bacterial protein Ybak preferentially hydrolyses Cys-tRNA(Pro) and Cys-tRNA(Cys) [ (PUBMED:15886196) (PUBMED:23185990) ]. ProX functions in trans to edit the amino acid moiety from incorrectly charged Ala-tRNA(Pro) [ (PUBMED:14663147) ]. Prolyl-tRNA synthetases main function is to catalyse the attachment of proline to tRNA(Pro) in a two-step reaction: proline is first activated by ATP to form Pro-AMP and then transferred to the acceptor end of tRNA(Pro) [ (PUBMED:10642548) ].

  This entry represents a domain characteristic of Ybak and ProX, that can also be found with other domains in prolyl-tRNA synthetases.

• GO function: aminoacyl-tRNA editing activity (GO:0002161)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry tRNA_edit