The domain within your query sequence starts at position 52 and ends at position 81; the E-value for the zf-3CxxC domain shown below is 2.5e-6.
KTFARFHCPSCSRSWASGRVLIVFHMRWCE
zf-3CxxC |
 |
|---|
| PFAM accession number: | PF13695 |
|---|---|
| Interpro abstract (IPR027377): | This is a domain with several pairs of CxxC motifs, possibly representing a multiple zinc-binding region. Only one pair of cysteines is associated with a highly conserved histidine residue. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-3CxxC