The domain within your query sequence starts at position 333 and ends at position 431; the E-value for the zf-4CXXC_R1 domain shown below is 4.3e-40.
YDKVLGNTCHQCRQKTIDTKTVCRNQSCGGVRGQFCGPCLRNRYGEDVRTALLDPKWTCP PCRGICNCSYCRRRDGRCATGILIHLAKFYGYDNVKEYL
zf-4CXXC_R1 |
 |
|---|
| PFAM accession number: | PF10497 |
|---|---|
| Interpro abstract (IPR018866): | R1 is a transcription factor repressor that inhibits monoamine oxidase A gene expression. This domain is a four-CXXC zinc finger putative DNA-binding domain found at the C-terminal end of R1. The domain carries 12 cysteines of which four pairs are of the CXXC type [ (PUBMED:15654081) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-4CXXC_R1