The domain within your query sequence starts at position 3034 and ends at position 3102; the E-value for the zf-C4pol domain shown below is 6.1e-15.
CPVCDDLTQHGICSKCRSQPQHVAIILNQEIRELERKQEQLIKICRNCTGSFDRHIPCVS LNCPVLFKL
zf-C4pol |
![]() |
---|
PFAM accession number: | PF14260 |
---|---|
Interpro abstract (IPR025687): | In fission yeast, this zinc-finger domain appears is the region of Pol3 that binds directly to the B-subunit, Cdc1 [ (PUBMED:1960723) ]. Pol delta is a hetero-tetrameric enzyme comprising four evolutionarily well-conserved proteins: the catalytic subunit Pol3 and three smaller subunits Cdc1, Cdc27 and Cdm1 [ (PUBMED:19686603) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-C4pol