The domain within your query sequence starts at position 123 and ends at position 163; the E-value for the zf-LITAF-like domain shown below is 3.7e-11.
FEGAPVQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGK
zf-LITAF-like |
---|
PFAM accession number: | PF10601 |
---|---|
Interpro abstract (IPR006629): | LITAF (LPS-induced TNF-activating factor) (also known as SIMPLE; small integral membrane protein of the late endosome) is an endosome-associated integral membrane protein important for multivesicular body (MVB) sorting. It is a monotypic membrane protein with both termini exposed to the cytoplasm and is anchored to membranes via an in-plane helical membrane anchor, present within the highly conserved C-terminal region known as the 'LITAF domain' or 'SIMPLE-like domain'. The LITAF domain consists of conserved cysteines separated by a 22 residue hydrophobic region. LITAF domains are found throughout the eukaryotes, suggesting ancient conserved functions, with multiple instances of expansion, especially in the metazoa [ (PUBMED:27582497) (PUBMED:27927196) ]. The LITAF domain consists of five beta-sheets, three N-terminal and two C- terminal to the predicted hydrophobic anchor region and is stabilized by the coordination of a zinc atom by two pairs of evolutionarily conserved cysteine residues. Consistent with a protein domain that resides in close proximity to membranes, specific residues within the LITAF domain interact with phosphoethanolamine (PE) head groups. The anchoring-region of the LITAF domain is likely to embed into the cytosolic-facing monolayer of the membrane bilayer by adopting an amphipathic character [ (PUBMED:27927196) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-LITAF-like