The domain within your query sequence starts at position 279 and ends at position 311; the E-value for the zf-NADH-PPase domain shown below is 5.9e-11.
SRYKFCPTCGSATKIEEGGYKRVCVRETCPSLQ
zf-NADH-PPase |
![]() |
---|
PFAM accession number: | PF09297 |
---|---|
Interpro abstract (IPR015376): | This domain has a zinc ribbon structure and is often found between two NUDIX domains. |
GO function: | hydrolase activity (GO:0016787), metal ion binding (GO:0046872) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-NADH-PPase