The domain within your query sequence starts at position 197 and ends at position 403; the E-value for the zf-SNAP50_C domain shown below is 3.3e-76.
YQTMLVLGSQKLTELRDSICCVSDLQIGGEFSNAPDQAPEHISKDLYKSAFFYFEGTFYN DRRYPECRDLSRTIIEWSESHDRGYGKFQTARMEDFTFNDLHIKLGFPYLYCHQGDCEHV VVITDIRLVHHDDCLDRTLYPLLTKKHWLWTRKCFVCKMYTARWVTNNDTFAPEDPCFFC DVCFRMLHYDSEGNKLGEFLAYPYVDP
zf-SNAP50_C |
![]() |
---|
PFAM accession number: | PF12251 |
---|---|
Interpro abstract (IPR022042): | snRNA-activating protein complex 50kDa subunit (SNAP50), also known as subunit 3, is part of the snRNA-activating protein complex which activates RNA polymerases II and III [ (PUBMED:9003788) ]. It contains a cysteine-histidine cluster with two possible zinc finger motifs. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-SNAP50_C