The domain within your query sequence starts at position 16 and ends at position 46; the E-value for the zf-TRM13_CCCH domain shown below is 1.9e-14.

DGRCNYFVEKKKRFCRMVAAAGKRFCGEHAG

zf-TRM13_CCCH

zf-TRM13_CCCH
PFAM accession number:PF11722
Interpro abstract (IPR021721):

This domain is found at the N terminus of TRM13 methyltransferase proteins. It is presumed to be a zinc binding domain.

GO function:methyltransferase activity (GO:0008168)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-TRM13_CCCH