SMART: Pfam domain zf-UBR

The domain within your query sequence starts at position 1660 and ends at position 1725; the E-value for the zf-UBR domain shown below is 1.9e-9.

LCTFTITQKEFMNQHWYHCHTCKMVDGVGVCTVCAKVCHKDHEISYAKYGSFFCDCGAKE
DGSCLA

zf-UBR

PFAM accession number:	PF02207
Interpro abstract (IPR003126):	It has been observed that the identity of N-terminal residues of a protein is related to the half life of the protein. This observation yields a rule, called the N-end rule [ (PUBMED:8901547) ]. Similar but distinct versions of the N-end rule operate in all organisms examined, from mammals to fungi and bacteria. In eukaryotes, the N-end rule pathway is a part of the ubiquitin degradation system. Some proteins that have a very short half life contain a specific motif at their N terminus, the N-degron. It consists of a destabilising N-terminal residue and an internal Lys, which is the site of poly-Ub chain [ (PUBMED:8901547) (PUBMED:10545113) ]. The UBR1 protein was shown to bind specifically to proteins bearing N-terminal residues that are destabilising according to the N-end rule, but not to otherwise identical proteins bearing stabilising N-terminal residues [ (PUBMED:10581257) ]. UBR1 contains an N-terminal conserved region (the UBR-type zinc finger) which is also found in various proteins implicated in N-degron recognition. The UBR-type zinc finger defines a unique E3 class, most likely N-degron specific [ (PUBMED:16055722) ].
GO function:	zinc ion binding (GO:0008270)

PFAM accession number:

PF02207

Interpro abstract (IPR003126):

It has been observed that the identity of N-terminal residues of a protein is related to the half life of the protein. This observation yields a rule, called the N-end rule [ (PUBMED:8901547) ]. Similar but distinct versions of the N-end rule operate in all organisms examined, from mammals to fungi and bacteria. In eukaryotes, the N-end rule pathway is a part of the ubiquitin degradation system. Some proteins that have a very short half life contain a specific motif at their N terminus, the N-degron. It consists of a destabilising N-terminal residue and an internal Lys, which is the site of poly-Ub chain [ (PUBMED:8901547) (PUBMED:10545113) ].

The UBR1 protein was shown to bind specifically to proteins bearing N-terminal residues that are destabilising according to the N-end rule, but not to otherwise identical proteins bearing stabilising N-terminal residues [ (PUBMED:10581257) ]. UBR1 contains an N-terminal conserved region (the UBR-type zinc finger) which is also found in various proteins implicated in N-degron recognition. The UBR-type zinc finger defines a unique E3 class, most likely N-degron specific [ (PUBMED:16055722) ].

GO function:

zinc ion binding (GO:0008270)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-UBR