The domain within your query sequence starts at position 15 and ends at position 58; the E-value for the zf-tcix domain shown below is 1.1e-22.
SDLGKATLRGIRKCPRCGTFNGTRGLSCKNKTCGTIFRYGARKQ
zf-tcix |
![]() |
---|
PFAM accession number: | PF14952 |
---|---|
Interpro abstract (IPR029269): | This entry represents a domain found in eukaryotic proteins. It resembles the zinc-binding domain of prokaryotic topoisomerases, IPR004149 . |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-tcix