The domain within your query sequence starts at position 1 and ends at position 166; the E-value for the RAS domain shown below is 3.7e-123.

All catalytic sites are present in this domain. Check the literature (PubMed 12927549 1785141 ) for details.

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQELARSYGIPFIETSAKTRQRVEDAFYTLVREIRQY

RAS

Ras subfamily of RAS small GTPases
RAS
SMART accession number:SM00173
Description: Similar in fold and function to the bacterial EF-Tu GTPase. p21Ras couples receptor Tyr kinases and G protein receptors to protein kinase cascades
Family alignment:
View or

There are 10915 RAS domains in 10905 proteins in SMART's nrdb database.

Click on the following links for more information.