The domain within your query sequence starts at position 385 and ends at position 578; the E-value for the RB_A domain shown below is 9.58e-119.

TPVASATQSVSRLQSIVAGLKSAPSEQLLNIFESCMRNPMGNIIKIVKGIGETFCQHYTQ
STDKQPGSHIDFAVNRLKLAEILYYKILETIMVQETRRLHGMDMSVLLEQDIFHKSLMAC
CLEIVLFAYSSPRTFPWIIEVLDLQPFYFYKVIEVVIRSEEGLSRDMVKHLNSIEEQILE
SLAWTNNSALWEAL

RB_A

Retinoblastoma-associated protein A domain
RB_A
SMART accession number:SM01368
Description: This domain has the cyclin fold as predicted PMID:8152925, 9495340.
Interpro abstract (IPR002720):

Retinoblastoma-like and retinoblastoma-associated proteins may have a function in cell cycle regulation. They form a complex with adenovirus E1A and Simian virus 40 (SV40) large T antigen, and may bind and modulate the function of certain cellular proteins with which T and E1A compete for pocket binding. The proteins may act as tumor suppressors, and are potent inhibitors of E2F-mediated trans-activation. This domain has the cyclin fold [ (PUBMED:8152925) ].

The crystal structure of the Rb pocket bound to a nine-residue E7 peptide containing the LxCxE motif, shared by other Rb-binding viral and cellular proteins, shows that the LxCxE peptide binds a highly conserved groove on the B-box portion of the pocket; the A-box portion appears to be required for the stable folding of the B box (see IPR002719 ). Also highly conserved is the extensive A-B interface, suggesting that it may be an additional protein-binding site. The A and B boxes each contain the cyclin-fold structural motif, with the LxCxE-binding site on the B-box cyclin fold being similar to a Cdk2-binding site of cyclin A and to a TBP-binding site of TFIIB [ (PUBMED:9495340) ].

The A and B boxes are found at the C-terminal end of the protein; the A-box is on N-terminal side of the B-box.

GO process:regulation of cell cycle (GO:0051726)
GO component:nucleus (GO:0005634)
Family alignment:
View or

There are 1890 RB_A domains in 1888 proteins in SMART's nrdb database.

Click on the following links for more information.