The domain within your query sequence starts at position 438 and ends at position 656; the E-value for the RFX5_DNA_bdg domain shown below is 4.29e-130.
LGPGRVPPRAPILPRGAENREVGISSDPRPHDKGIKRTAEVPLSEASGQDPPVKEMKHET QDTTVSEAKRKRGRPRKKPGGSGERNATPEKSAAIVNSPRSPRLLWETWGSKRENNFIGR PEGPGPGGEAERETVLVQGQQDGAVSKGERSLSSQEAKEAEDKIPPVTSKVSVIKGRIQK EALQLVKGEADAATQGNKGLKGRVLQSSLTPEHKDPKAT
RFX5_DNA_bdgRFX5 DNA-binding domain |
|---|
| SMART accession number: | SM01306 |
|---|---|
| Description: | RFX5 and RFXAP reveals molecular details associated with MHCII gene expression. |
| Interpro abstract (IPR029298): | Transcription of all the members of MHCII family of genes is controlled by a set of conserved transcription factors and promoter elements. One of these class II transactivators is the DNA-binding RFX complex, which consists of subunits RFX5 and its accessory proteins RFXAP and RFXANK [ (PUBMED:10779326) ]. This entry represents the C-terminal domain of RFX5. The C-terminal domain mediates cooperative binding between the RFX complex and NF-Y, a transcription factor binding to the Y box sequence of MHC-II promoters [ (PUBMED:10779326) ]. |
| Family alignment: |
There are 128 RFX5_DNA_bdg domains in 128 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Links (links to other resources describing this domain)