The domain within your query sequence starts at position 764 and ends at position 896; the E-value for the RIBOc domain shown below is 1.6e-49.
RLLARAFTLRTVGFNHLTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSL VNNRTQAKVAEELGMQEYAITNDKTKRPVALRTKTLADLLESFIAALYIDKDLEYVHTFM NVCFFPRLKEFIL
RIBOcRibonuclease III family |
---|
SMART accession number: | SM00535 |
---|---|
Description: | - |
Interpro abstract (IPR000999): | This domain is found in eukaryotic, bacterial and archeal ribonuclease III (RNAse III) proteins. RNAse III is a double stranded RNA-specific endonuclease [ (PUBMED:11738048) (PUBMED:15016361) ]. Prokaryotic RNAse III is important in post-transcriptional control of mRNA stability and translational efficiency. It is involved in the processing of ribosomal RNA precursors. Prokaryotic RNAse III also plays a role in the maturation of tRNA precursors and in the processing of phage and plasmid transcripts. Eukaryotic RNase III's participate (through direct cleavage) in rRNA processing, in processing of small nucleolar RNAs (snoRNAs) and snRNA's (components of the spliceosome). In eukaryotes RNase III or RNaseIII like enzymes such as Dicer are involved in RNAi (RNA interference) and miRNA (micro-RNA) gene silencing [ (PUBMED:14983173) (PUBMED:15066275) (PUBMED:11809414) ]. |
GO process: | RNA processing (GO:0006396) |
GO function: | ribonuclease III activity (GO:0004525) |
Family alignment: |
There are 34155 RIBOc domains in 30210 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Literature (relevant references for this domain)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)