The domain within your query sequence starts at position 523 and ends at position 742; the E-value for the RICTOR_M domain shown below is 5.66e-98.

DTEEALLINLRDSQVLQHKENLDWDWNLIGTILKWPNVNLRNYKDEQLHRFVRRLLYFYK
PSSKLYASLDLDLAKSKQLTVVGCQFTEFLLESEEDGQGYLEDLVKDIVQWLNASSGVKP
ERSLQNNGLLTTLSQHYFLFIGTLSCHPHGVKMLEKCSVFQCLLNLCSLKNQDHLIKLTV
SSLDYSRDGLARVILSKILTAATDACRLYATKHLRVLLRA

RICTOR_M

Rapamycin-insensitive companion of mTOR, middle domain
RICTOR_M
SMART accession number:SM01307
Description: Rictor appears to serve as a scaffolding protein that is important for maintaining mTORC2 integrity. The mammalian target of rapamycin (mTOR) is a conserved Ser/Thr kinase that forms two functionally distinct complexes, mTROC1 and mTORC2, important for nutrient and growth-factor signalling. This region is the more conserved central section that may include several individual domains. Rictor can be inhibited in the short-term by rapamycin.
Interpro abstract (IPR029451):

This domain is found in the more conserved central section of Rictor (rapamycin-insensitive companion of mTOR) that may include several individual domains.

The mammalian target of rapamycin (mTOR) is a conserved Ser/Thr kinase that forms two functionally distinct complexes, mTROC1 and mTORC2, important for nutrient and growth-factor signalling. Rictor is a component of mTORC2 [ (PUBMED:15268862) ]. There is a regulatory link between the two mTOR complexes, whereby Rictor phosphorylation by mTORC1 regulates mTORC2 signalling [ (PUBMED:19995915) ]. Over-expression of Rictor increases mTORC2 activity and promotes cell growth and motility [ (PUBMED:18089801) ].

Family alignment:
View or

There are 1433 RICTOR_M domains in 1433 proteins in SMART's nrdb database.

Click on the following links for more information.