The domain within your query sequence starts at position 920 and ends at position 992; the E-value for the RICTOR_V domain shown below is 1.44e-40.

IKKLKASLWALGNIGSSNWGLNLLQEENVIPDILKLAKQCEVLSIRGTCVYVLGLIAKTK
QGCDILKCHSWDS

RICTOR_V

Rapamycin-insensitive companion of mTOR, domain 5
RICTOR_V
SMART accession number:SM01310
Description: Rictor appears to serve as a scaffolding protein that is important for maintaining mTORC2 integrity. The mammalian target of rapamycin (mTOR) is a conserved Ser/Thr kinase that forms two functionally distinct complexes, mTROC1 and mTORC2, important for nutrient and growth-factor signalling. These long eukaryotic proteins carry several well-conserved domains, and this is No.5.
Interpro abstract (IPR029452):

The mammalian target of rapamycin (mTOR) is a conserved Ser/Thr kinase that forms two functionally distinct complexes, mTROC1 and mTORC2, important for nutrient and growth-factor signalling. Rictor (rapamycin-insensitive companion of mTOR) is a component of mTORC2 [ (PUBMED:15268862) ]. There is a regulatory link between the two mTOR complexes, whereby Rictor phosphorylation by mTORC1 regulates mTORC2 signalling [ (PUBMED:19995915) ]. Over-expression of Rictor increases mTORC2 activity and promotes cell growth and motility [ (PUBMED:18089801) ].

This entry represent the conserved domain 5 of the Rictor (Rapamycin-insensitive companion of mTOR) protein.

Family alignment:
View or

There are 1479 RICTOR_V domains in 1476 proteins in SMART's nrdb database.

Click on the following links for more information.