The domain within your query sequence starts at position 2 and ends at position 147; the E-value for the RPOL8c domain shown below is 5.28e-93.

AGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIA
STLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGL
LMRLQGDANNLHGFEVDSRVYLLMKK

RPOL8c

RNA polymerase subunit 8
RPOL8c
SMART accession number:SM00658
Description: subunit of RNA polymerase I, II and III
Interpro abstract (IPR005570):

Rpb8 is a subunit common to the three yeast RNA polymerases, pol I, II and III. Rpb8 interacts with the largest subunit Rpb1, and with Rpb3 and Rpb11, two smaller subunits.

GO process:transcription, DNA-templated (GO:0006351)
Family alignment:
View or

There are 1134 RPOL8c domains in 1133 proteins in SMART's nrdb database.

Click on the following links for more information.