The domain within your query sequence starts at position 947 and ends at position 1063; the E-value for the Rb_C domain shown below is 2.29e-11.

SNQDHIMDAPPLSPFPHIKQQPGSPRRISQQHSLYVSPHKNGAGLTPRSALLYKFNGSPS
KSLKDINNMIRQGEQKTKKRVIAISGDADSPAKRLCQENDDVLLKRLQDVVSERANH

Rb_C

Rb C-terminal domain
Rb_C
SMART accession number:SM01369
Description: The Rb C-terminal domain is required for high-affinity binding to E2F-DP complexes and for maximal repression of E2F-responsive promoters, thereby acting as a growth suppressor by blocking the G1-S transition of the cell cycle. This domain has a strand-loop-helix structure, which directly interacts with both E2F1 and DP1, followed by a tail segment that lacks regular secondary structure (PMID:16360038).
Interpro abstract (IPR015030):

The RB C-terminal domain is required for high-affinity binding to E2F-DP complexes and for maximal repression of E2F-responsive promoters, thereby acting as a growth suppressor by blocking the G1-S transition of the cell cycle. This domain has a strand-loop-helix structure, which directly interacts with both E2F1 and DP1, followed by a tail segment that lacks regular secondary structure [ (PUBMED:16360038) ].

Family alignment:
View or

There are 1145 Rb_C domains in 1145 proteins in SMART's nrdb database.

Click on the following links for more information.