The domain within your query sequence starts at position 13 and ends at position 79; the E-value for the Romo1 domain shown below is 1.34e-31.

PSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMA
IGMGIRC

Romo1

Reactive mitochondrial oxygen species modulator 1
Romo1
SMART accession number:SM01378
Description: This is a family of small, approximately 100 amino acid, proteins found from yeasts to humans. The majority of endogenous reactive oxygen species (ROS) in cells are produced by the mitochondrial respiratory chain. An increase or imbalance in ROS alters the intracellular redox homeostasis, triggers DNA damage, and may contribute to cancer development and progression (PMID:16842742). Members of this family are mitochondrial reactive oxygen species modulator 1 (Romo1) proteins that are responsible for increasing the level of ROS in cells. Increased Romo1 expression can have a number of other effects including: inducing premature senescence of cultured human fibroblasts (PMID:18313394, 18836179) and increased resistance to 5-fluorouracil (PMID:17537404).
Interpro abstract (IPR018450):

This entry includes a group of mitochondrial proteins, including reactive oxygen species modulator 1 (Romo1) from animals and Mgr2 from fungi.

Budding yeast Mgr2 is a subunit of the TIM23 translocase complex, which translocates preproteins into and across the membrane and associates with the matrix-localized import motor. It is required for binding of Tim21 to TIM23(CORE). Mrg2 is essential for cell growth at elevated temperature and for efficient protein import [ (PUBMED:22613836) ].

Romo1 is responsible for increasing the level of ROS in cells. In various cancer cell lines with elevated levels of ROS there is also an increased abundance of Romo1 [ (PUBMED:16842742) ]. Increased Romo1 expression can have a number of other affects including: inducing premature senescence of cultured human fibroblasts [ (PUBMED:18836179) (PUBMED:18313394) ] and increased resistance to 5-fluorouracil [ (PUBMED:17537404) ].

Family alignment:
View or

There are 1136 Romo1 domains in 1135 proteins in SMART's nrdb database.

Click on the following links for more information.