The domain within your query sequence starts at position 108 and ends at position 179; the E-value for the S4 domain shown below is 6.84e-4.

RRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGG
GRPGRVKRKNAK

S4

S4 RNA-binding domain
S4
SMART accession number:SM00363
Description: -
Interpro abstract (IPR002942):

The S4 domain is a small domain consisting of 60-65 amino acid residues that was detected in the bacterial ribosomal protein S4, eukaryotic ribosomal S9, two families of pseudouridine synthases, a novel family of predicted RNA methylases, a yeast protein containing a pseudouridine synthetase and a deaminase domain, bacterial tyrosyl-tRNA synthetases, and a number of uncharacterised, small proteins that may be involved in translation regulation [ (PUBMED:10093218) ]. The S4 domain probably mediates binding to RNA [ (PUBMED:9707415) ].

GO function:RNA binding (GO:0003723)
Family alignment:
View or

There are 146383 S4 domains in 146322 proteins in SMART's nrdb database.

Click on the following links for more information.