The domain within your query sequence starts at position 42 and ends at position 126; the E-value for the SAM_PNT domain shown below is 1.39e-35.

CNVSSGFFGSQWHEIHPQYWTKYQVWEWLQHLLDTNQLDASCIPFQEFDISGEHLCSMSL
QEFTRAAGSAGQLLYSNLQHLKWNG

SAM_PNT

SAM / Pointed domain
SAM_PNT
SMART accession number:SM00251
Description: A subfamily of the SAM domain
Interpro abstract (IPR003118):

The highly conserved PNT (or Pointed) domain is found within a subset of the Ets transcription factors, including mammalian Ets-1, Ets-2, Erg, Fli-1, GABPalpha, and Tel, as well as Drosophila Pnt-P2 and Yan. The PNT domain is structurally related to the larger group of SAM domains through a common tertiary arrangement of four alpha-helices. A role in protein-protein association has been established for the PNT domain [ (PUBMED:10828014) (PUBMED:15351649) ].

GO function:sequence-specific DNA binding (GO:0043565)
Family alignment:
View or

There are 5576 SAM_PNT domains in 5570 proteins in SMART's nrdb database.

Click on the following links for more information.