SMART: SCOP domain d1a4ya

The domain within your query sequence starts at position 236 and ends at position 415; the E-value for the d1a4ya_ domain shown below is 2e-11.

EVTKLLSHTIQLDSLSLSKIACRSLNGRTFRNFITQLSRMNHLKELSLSSFCLTDHLENV
LRVLSADLEFLYLPFCGLSYSDFKFLSECSQVSHLKLLNVNNNPIYWEDCEPFYYLLQNV
SSTLQHLKICYCFLTDSTISVLIPALTRCSQLRVLHFYSNQITMGMLMRILELLTPLKEL

The domain within your query sequence starts at position 236 and ends at position 415; the E-value for the d1a4ya_ domain shown below is 2e-11.

This is a SCOP domain - please see the SCOP entry of d1a4ya_ for further annotation