SMART: SCOP domain d1e8xa3

The domain within your query sequence starts at position 223 and ends at position 371; the E-value for the d1e8xa3 domain shown below is 2e-42.

ESTEPIGCPIEIVEVPQGSNKNLASFCNKVKKIRESYHASDINSNSGKIWAITTAYPSRL
FADTKFRVKISIDNSAQLLLLMPHANYLVKDLIAEILLLCANEPLSPKEYLLSVCGSEEF
LQMDHSLGGHKIFQKNKSVIQLHLQKNRD

The domain within your query sequence starts at position 223 and ends at position 371; the E-value for the d1e8xa3 domain shown below is 2e-42.

This is a SCOP domain - please see the SCOP entry of d1e8xa3 for further annotation