SMART: SCOP domain d1f5aa2

The domain within your query sequence starts at position 563 and ends at position 711; the E-value for the d1f5aa2 domain shown below is 5e-3.

KEHQRILARRQTIEERKERLESLNIQREKEELEQREAELQKVRKAEEERLRQEAKEREKE
RILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIEDLEELDPDFIMAKQVEQLEKEKK
ELQERLKNQEKKIDYFERAKRLEEIPLIK

The domain within your query sequence starts at position 563 and ends at position 711; the E-value for the d1f5aa2 domain shown below is 5e-3.

This is a SCOP domain - please see the SCOP entry of d1f5aa2 for further annotation