SMART: SCOP domain d1gw5a

The domain within your query sequence starts at position 2 and ends at position 172; the E-value for the d1gw5a_ domain shown below is 2e-3.

DPECSRLLPALCAVLADPRQLVADDTCLEKLLDWFKTVTEAESSLQLLQDHPCLMELLSH
VLKPQDVSPRVLSFALRLVGVFAAQEDCFEYLQQGELLLGLFGESGAPGWAAWSIPSVRS
GWIQGLCYLAHHPSALHFLADSGAVDTLFSLQGDPSLFVASAASQLLVHIL

The domain within your query sequence starts at position 2 and ends at position 172; the E-value for the d1gw5a_ domain shown below is 2e-3.

This is a SCOP domain - please see the SCOP entry of d1gw5a_ for further annotation