SMART: SCOP domain d1hu4a

The domain within your query sequence starts at position 1 and ends at position 151; the E-value for the d1hu4a_ domain shown below is 1e-28.

LSVNTLGPIGVTLALLPLLQQARGRVVNITSVLGRIAANGGGYCVSKFGLEAFSDSLRRD
MAPFGVQVSIVEPGFFRTPVTNLESLESTLKACWARLPPAIQAHYGEAFLDTSTDLRVQR
RIMNLICDPELTKVTSCLEHALTARHPRTRY

The domain within your query sequence starts at position 1 and ends at position 151; the E-value for the d1hu4a_ domain shown below is 1e-28.

This is a SCOP domain - please see the SCOP entry of d1hu4a_ for further annotation