SMART: SCOP domain d1jdha

The domain within your query sequence starts at position 63 and ends at position 222; the E-value for the d1jdha_ domain shown below is 2e-4.

HILLWMSDDEIYANCHKMLGENGQVIAPSRESTEAGALDKSVLGEMETDVKSLIQRALRQ
LEECVGTVPPAPLLHTVHVLSAYASIEPLTGIFKDRRVVNLLMHMLSSPDYQIRWSAGRM
IQALSSHDAGTRTQILLSLSQQEAIEKHLDFDSRCALLAL

The domain within your query sequence starts at position 63 and ends at position 222; the E-value for the d1jdha_ domain shown below is 2e-4.

This is a SCOP domain - please see the SCOP entry of d1jdha_ for further annotation