SMART: SCOP domain d1jpna2

The domain within your query sequence starts at position 1 and ends at position 149; the E-value for the d1jpna2 domain shown below is 6e-11.

MDVNIGHEVGYVIPFENCCTTETILRYCTDDMLQREMMSNPFLGSYGVIILDDVHERSLA
TDVLLGLLKDVLLARPELKLIVNCSPLLTSKLSSYYGDVPVIEVRNKHPVEVVYLSGAQK
DSFESVIRLIFEIHRSGEKGDVVVFLACE

The domain within your query sequence starts at position 1 and ends at position 149; the E-value for the d1jpna2 domain shown below is 6e-11.

This is a SCOP domain - please see the SCOP entry of d1jpna2 for further annotation