SMART: SCOP domain d1saca

The domain within your query sequence starts at position 2 and ends at position 159; the E-value for the d1saca_ domain shown below is 5e-14.

TNSSHYWMAFIYITNNTLLGREDVDLGLAGDHQQLILYSFGKTFYVSYHLIPFHWHTLCL
VWDGVKGRLELFRNKERILAIMDQPHRLSPNGTLVLGHFPRNGEGQIKTVIPRFTSSLYY
FQLWDRILENEEFMTCFYGNVVSWEDDVWLIHKISPTV

The domain within your query sequence starts at position 2 and ends at position 159; the E-value for the d1saca_ domain shown below is 5e-14.

This is a SCOP domain - please see the SCOP entry of d1saca_ for further annotation