SMART: SCOP domain d1tbga

The domain within your query sequence starts at position 18 and ends at position 171; the E-value for the d1tbga_ domain shown below is 6e-8.

FNQDHGCFACGMENGFRVYNTDPLKEKEKQVMIWDDLKKKTVIEIEFSTEVKAVKLRRDR
IVVVLDSMIKVFTFTHNPHQLHVFETCYNPKGLCVLCPNSNNSLLAFPGTHTGHVQLVDL
ASTEKPPVDIPAHEGVLSCIALNLQGTRIATASE

The domain within your query sequence starts at position 18 and ends at position 171; the E-value for the d1tbga_ domain shown below is 6e-8.

This is a SCOP domain - please see the SCOP entry of d1tbga_ for further annotation