SMART: SCOP domain d1tubb2

The domain within your query sequence starts at position 37 and ends at position 184; the E-value for the d1tubb2 domain shown below is 2e-22.

LGDLMEHLVPHPEFKMLGVRNIPQMSAASLAYSAFTWAGLLKHLRQMLISSAKMEEEGFK
DPALYTSWLEPVDAFSVWKTQRAFDKYEKSAALVSNSQLLVKPLDMIVGKAWNMFSSKAF
IHQYTKFGMEEEDFLDSFALLEQVVASY

The domain within your query sequence starts at position 37 and ends at position 184; the E-value for the d1tubb2 domain shown below is 2e-22.

This is a SCOP domain - please see the SCOP entry of d1tubb2 for further annotation