SMART: SCOP domain d1utea

The domain within your query sequence starts at position 15 and ends at position 176; the E-value for the d1utea_ domain shown below is 3e-11.

EPLFSFGVIADIQYADLEDGYNYQRSRRRYYRHSLIHLQGAIEDWNKESSMPCCVLQLGD
IIDGYNAQYKVSEKSLELVMNTFQMLKVPVHHTWGNHEFYNFSRDYLASSKLNSKFLEDQ
IAQHPETTPSENYYAYHFVPFPKFRFILLDSYDLSVLGIDPS

The domain within your query sequence starts at position 15 and ends at position 176; the E-value for the d1utea_ domain shown below is 3e-11.

This is a SCOP domain - please see the SCOP entry of d1utea_ for further annotation