The domain within your query sequence starts at position 79 and ends at position 129; the E-value for the SFM domain shown below is 3.33e-24.
LSRQEVIRRLRERGEPIRLFGETDYDAFQRLRKIEILTPEVNKGLRNDLKA
SFMSplicing Factor Motif, present in Prp18 and Pr04 |
---|
SMART accession number: | SM00500 |
---|---|
Description: | - |
Interpro abstract (IPR014906): | This small domain is found on PRP4 ribonuleoproteins. PRP4 is a U4/U6 small nuclear ribonucleoprotein that is involved in pre-mRNA processing [ (PUBMED:528687) ]. It is also found in pre-mRNA-splicing factor 18 [ (PUBMED:9000057) ]. |
Family alignment: |
There are 1137 SFM domains in 1133 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)