The domain within your query sequence starts at position 513 and ends at position 629; the E-value for the SMC_hinge domain shown below is 5.39e-34.
GSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFLP LDYLEVKPTDEKLRELKGAKLVIDVIRYEPPHIKKALQYACGNALVCDNVEDARRIA
SMC_hingeSMC proteins Flexible Hinge Domain |
---|
SMART accession number: | SM00968 |
---|---|
Description: | This entry represents the hinge region of the SMC (Structural Maintenance of Chromosomes) family of proteins. The hinge region is responsible for formation of the DNA interacting dimer. It is also possible that the precise structure of it is an essential determinant of the specificity of the DNA-protein interaction (PUBMED:12411491). |
Interpro abstract (IPR010935): | This entry represents the hinge region of the SMC (Structural Maintenance of Chromosomes) family of proteins. The hinge region is responsible for formation of the DNA interacting dimer. It is also possible that its precise structure is an essential determinant of the specificity of the DNA-protein interaction [ (PUBMED:12411491) ]. |
GO process: | chromosome organization (GO:0051276) |
GO component: | chromosome (GO:0005694) |
GO function: | ATP binding (GO:0005524), protein binding (GO:0005515) |
Family alignment: |
There are 21778 SMC_hinge domains in 21762 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Literature (relevant references for this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)