The domain within your query sequence starts at position 3376 and ends at position 3479; the E-value for the SPEC domain shown below is 3.58e-15.
QGFHSEIEDFLLELNRMENQLSASKPTGGLPETAREQLDTHMELHSQLRAKEEIYNQLLD KGRLMLLSRGDSGSGSKTEQSVALLEQKWHAVSSKVEERKSKLE
SPECSpectrin repeats |
---|
SMART accession number: | SM00150 |
---|---|
Description: | - |
Interpro abstract (IPR018159): | Spectrin repeats [ (PUBMED:8266097) ] are found in several proteins involved in cytoskeletal structure. These include spectrin alpha and beta subunits [ (PUBMED:12672815) (PUBMED:15062087) ], alpha-actinin [ (PUBMED:10481917) ] and dystrophin. The spectrin repeat forms a three-helix bundle. The second helix is interrupted by proline in some sequences. The repeats are defined by a characteristic tryptophan (W) residue at position 17 in helix A and a leucine (L) at 2 residues from the carboxyl end of helix C. |
Family alignment: |
There are 257395 SPEC domains in 23741 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Literature (relevant references for this domain)
- Disease (disease genes where sequence variants are found in this domain)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)