The domain within your query sequence starts at position 4974 and ends at position 5080; the E-value for the SPEC domain shown below is 1.8e-2.

KEFQESFKNIEKKVEGAKHQLEIFDALGSQACSNKNLEKLKAQQEVLQALEPQVDYLRNF
TQGLVEDAPDGSDASPLVHQAEVAQQEFLEVKQRVSSSCLTMENKLE

SPEC

Spectrin repeats
SPEC
SMART accession number:SM00150
Description: -
Interpro abstract (IPR018159):

Spectrin repeats [ (PUBMED:8266097) ] are found in several proteins involved in cytoskeletal structure. These include spectrin alpha and beta subunits [ (PUBMED:12672815) (PUBMED:15062087) ], alpha-actinin [ (PUBMED:10481917) ] and dystrophin. The spectrin repeat forms a three-helix bundle. The second helix is interrupted by proline in some sequences. The repeats are defined by a characteristic tryptophan (W) residue at position 17 in helix A and a leucine (L) at 2 residues from the carboxyl end of helix C.

Family alignment:
View or

There are 257395 SPEC domains in 23741 proteins in SMART's nrdb database.

Click on the following links for more information.