The domain within your query sequence starts at position 529 and ends at position 689; the E-value for the SPT16 domain shown below is 3.38e-96.

IYIDKKYETVIMPVFGIATPFHIATIKNISMSVEGDYTYLRINFYCPGSALGRNEGNIFP
NPEATFVKEITYRASNMKAPGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQ
DSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRF

SPT16

FACT complex subunit (SPT16/CDC68)
SPT16
SMART accession number:SM01286
Description: Proteins in this family are subunits the FACT complex. The FACT complex plays a role in transcription initiation and promotes binding of TATA-binding protein (TBP) to a TATA box in chromatin PMID:15987999.
Interpro abstract (IPR013953):

Proteins in this entry are subunits the FACT complex; the FACT complex is a stable heterodimer in Saccharomyces cerevisiae comprising Spt16 and Pob3. The complex plays a role in transcription initiation and promotes binding of TATA-binding protein (TBP) to a TATA box in chromatin [ (PUBMED:15987999) ]; it also facilitates RNA polymerase II transcription elongation through nucleosomes by destabilising and then reassembling nucleosome structure [ (PUBMED:12524332) (PUBMED:12934006) ].

The proteins in this entry are non-peptidase homologues belonging to MEROPS peptidase family M24 (clan MG).

Family alignment:
View or

There are 1690 SPT16 domains in 1688 proteins in SMART's nrdb database.

Click on the following links for more information.