The domain within your query sequence starts at position 354 and ends at position 452; the E-value for the SR domain shown below is 1.65e-34.

ARLLGGVHPCEGRLEVLRGLTWGTVCHDDLDLPMAHVVCRELGCGTAVSILGSSHFGYGS
GPLWTEAFRCMGNESLLFHCLREPGHQCGHDQDAALICS

SR

Scavenger receptor Cys-rich
SR
SMART accession number:SM00202
Description: The sea ucrhin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.
Interpro abstract (IPR017448):

The scavenger receptor cysteine-rich (SRCR) domain is an ancient and highly conserved domain of about 110 residues which is found in diverse secreted and cell-surface proteins, like the type I scavenger receptor, the speract receptor, CD5/Ly-1, CD6, or complement factor I [ (PUBMED:1978939) ]. Tandem repeats of SRCR domains are common in the membrane bound proteins. Most SRCR domains have six to eight cysteines that participate in intradomain disulfide bonds. SRCR domains have been subdivided into two groups, A and B, primarily on the differences in the spacing pattern between the cysteine residues [ (PUBMED:8140623) (PUBMED:10074941) ]. Besides type I scavenger receptor, this domain can also be found in the N-terminal of hepsin [ (PUBMED:12962630) ].

GO component:membrane (GO:0016020)
Family alignment:
View or

There are 45697 SR domains in 14875 proteins in SMART's nrdb database.

Click on the following links for more information.