The domain within your query sequence starts at position 318 and ends at position 395; the E-value for the SRP54_N domain shown below is 4.04e-6.

MFGMLKGLVGSKSLSREDMESVLDKMRDHLIAKNVAADIAVQLCESVANKLEGKVMGTFS
TVTSTVKQALQESLVQIL

SRP54_N

SRP54-type protein, helical bundle domain
SRP54_N
SMART accession number:SM00963
Description: This entry represents the N-terminal helical bundle domain of the 54 kDa SRP54 component, a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 of the signal recognition particle has a three-domain structure: an N-terminal helical bundle domain, a GTPase domain, and the M-domain that binds the 7s RNA and also binds the signal sequence. The extreme C-terminal region is glycine-rich and lower in complexity and poorly conserved between species.
Interpro abstract (IPR013822):

This entry represents the N-terminal helical bundle domain of the 54kDa SRP54 component, a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 of the signal recognition particle has a three-domain structure: an N-terminal helical bundle domain, a GTPase domain, and the M-domain that binds the 7s RNA and also binds the signal sequence. The extreme C-terminal region is glycine-rich and lower in complexity and poorly conserved between species.

Other proteins with this domain include signal recognition particle receptor alpha subunit (docking protein), an integral membrane GTP-binding protein which ensures (in conjunction with SRP) the correct targeting of nascent secretory proteins to the endoplasmic reticulum membrane; and bacterial FtsY protein, which is believed to play a similar role to that played by the eukaryotic docking protein.

GO process:SRP-dependent cotranslational protein targeting to membrane (GO:0006614)
GO function:GTP binding (GO:0005525)
Family alignment:
View or

There are 40739 SRP54_N domains in 40723 proteins in SMART's nrdb database.

Click on the following links for more information.