The domain within your query sequence starts at position 12 and ends at position 178; the E-value for the TAFII55_N domain shown below is 4.63e-94.
LESQFILRLPPEYAATVRRAVQSGHVNLKDKLSIELHPDGRHGIVRVDRVPLAAKLVDLP CVTESLKTIDKKTFYKTADISQMLVATVDGDLYPPVEEAAATADPKANKKKDKDKEKKFV WNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVS
TAFII55_NTAFII55 protein conserved region |
---|
SMART accession number: | SM01370 |
---|---|
Description: | The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex. TAFII55 binds to TAFII250 and inhibits it acetyltransferase activity. The exact role of TAFII55 is currently unknown. The conserved region is situated towards the N-terminus of the protein (PMID:11592977). |
Interpro abstract (IPR006751): | The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex. TAFII55 binds to TAFII250 and inhibits its acetyltransferase activity. The exact role of TAFII55 is currently unknown. The conserved region is situated towards the N-terminal of the protein [ (PUBMED:11592977) ]. |
GO process: | transcription initiation from RNA polymerase II promoter (GO:0006367) |
GO component: | transcription factor TFIID complex (GO:0005669) |
Family alignment: |
There are 1896 TAFII55_N domains in 1894 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)