The domain within your query sequence starts at position 293 and ends at position 390; the E-value for the TGFB domain shown below is 1.95e-39.
CCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASA SPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
TGFBTransforming growth factor-beta (TGF-beta) family |
---|
SMART accession number: | SM00204 |
---|---|
Description: | Family members are active as disulphide-linked homo- or heterodimers. TGFB is a multifunctional peptide that controls proliferation, differentiation, and other functions in many cell types. |
Interpro abstract (IPR001839): | Transforming growth factor-beta (TGF-beta) is a multifunctional peptide that controls proliferation, differentiation and other functions in many cell types. TGF-beta-1 is a peptide of 112 amino acid residues derived by proteolytic cleavage from the C-terminal of a precursor protein [ (PUBMED:8679613) ]. A number of proteins are known to be related to TGF-beta-1 [ (PUBMED:1575734) (PUBMED:8199356) ]. Proteins from the TGF-beta family are only active as homo- or heterodimer; the two chains being linked by a single disulphide bond. From X-ray studies of TGF-beta-2 [ (PUBMED:1631557) ], it is known that all the other cysteines are involved in intrachain disulphide bonds. There are four disulphide bonds in the TGF-beta's and in inhibin beta chains, while the other members of this family lack the first bond. The regulatory cytokine TGFbeta exerts tumour-suppressive effects, but also modulates cell invasion and immune regulation [ (PUBMED:18662538) ]. Misregulation of the TGF-beta signalling pathway can result in tumour development. |
GO function: | growth factor activity (GO:0008083) |
Family alignment: |
There are 13842 TGFB domains in 13809 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Literature (relevant references for this domain)
- Disease (disease genes where sequence variants are found in this domain)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)