The domain within your query sequence starts at position 190 and ends at position 287; the E-value for the THUMP domain shown below is 4.75e-12.

YENPAIKEEISTLVGDVLSSCKDETGQSLREETEPQVQKFRVTCNRAGEKHCFTSNEAAR
DFGGAIQEYFKWKADMTNFDVEVLLNIHDNEVIVAIAL

THUMP

THUMP
SMART accession number:SM00981
Description: The THUMP domain is named after after thiouridine synthases, methylases and PSUSs (PUBMED:11295541). The THUMP domain consists of about 110 amino acid residues. The structure of ThiI reveals that the THUMP has a fold unlike that of previously characterised RNA-binding domains (PUBMED:16343540). It is predicted that this domain is an RNA-binding domain The THUMP domain probably functions by delivering a variety of RNA modification enzymes to their targets (PUBMED:11295541).
Interpro abstract (IPR004114):

The THUMP (after thiouridine synthases, RNA methylases and pseudouridine synthases) domain is a module of 100-110 amino acid residues which is involved RNA metabolism. It is shared by enzymes that are predicted to carry out at least three unrelated types of RNA-modification, namely methylation, pseudouridylation and thiouridylation. The THUMP domain can occur in stand- alone form or in association with a variety of catalytic domains, like methylase, pseudo U-synthase or rhodanese. THUMP is an ancient domain with predicted RNA-binding capacity that probably functions by delivering a variety of RNA modification enzymes to their targets. The THUMP domain apparently evolved prior to the divergence of the primary divisions of life [ (PUBMED:11295541) ].

The THUMP domain has been predicted to adopt an alpha/beta fold similar to that found in the C-terminal domain of translation initiation factor 3 and ribosomal protein S8 [ (PUBMED:11295541) ].

Some proteins known to contain a THUMP domain are listed below:

  • Bacterial and archaeal thiI-like 4-thiouridine synthases.
  • Bacterial, archaeal and eukaryotic RNA methylases.
  • Archaeal pseudouridine synthases (PSUSs).
  • Several uncharacterised proteins.
GO function:RNA binding (GO:0003723)
Family alignment:
View or

There are 21235 THUMP domains in 21235 proteins in SMART's nrdb database.

Click on the following links for more information.