The domain within your query sequence starts at position 41 and ends at position 77; the E-value for the THY domain shown below is 5.7e-9.
LSEVERFDKSKLKKTITEVKNTLPSKETIEQEKEFVK
THYThymosin beta actin-binding motif. |
---|
SMART accession number: | SM00152 |
---|---|
Description: | - |
Interpro abstract (IPR001152): | This entry represents beta-thymosin family. Its members include thymosin beta-4, -10, -15 from humans and their homologues (such as thymosin beta 11/12) from fish. Thymosin beta-4 (Tbeta) is a small protein that sequesters actin monomers to help maintain the high concentrations of unpolymerised actin in higher eukaryotic cells. Its structure has been resolved [ (PUBMED:25313062) ]. It is a multiple function protein that plays important roles in cellular processes such as wound healing, embryonic organ development and the pathogeneses of disease [ (PUBMED:24993983) (PUBMED:24732964) ]. It plays a role in anti-apoptotic response to an external stress [ (PUBMED:15037574) ], paclitaxel-resistance via ROS production [ (PUBMED:18306930) (PUBMED:20637781) ] and HIF-1alpha stabilisation via Erk activation [ (PUBMED:18272284) ]. It also regulates cancer cell migration through various signalling pathways, and hence plays a role in malignant progression and invasion in colon adenocarcinoma [ (PUBMED:22328534) (PUBMED:12761500) ]. Thymosin beta-15 has been reported to be up-regulated in breast, brain, lung and head and neck cancer [ (PUBMED:17567946) ]. The expression of thymosin beta-10 is also associated with many cancers [ (PUBMED:24053380) ]. |
GO process: | actin filament organization (GO:0007015) |
GO function: | actin monomer binding (GO:0003785) |
Family alignment: |
There are 2289 THY domains in 910 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)