The domain within your query sequence starts at position 126 and ends at position 164; the E-value for the TNFR domain shown below is 2.59e-3.
CPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVC
TNFRTumor necrosis factor receptor / nerve growth factor receptor repeats. |
---|
SMART accession number: | SM00208 |
---|---|
Description: | Repeats in growth factor receptors that are involved in growth factor binding. TNF/TNFR |
Interpro abstract (IPR001368): | A number of proteins, some of which are known to be receptors for growth factors, have been found to contain a cysteine-rich domain of about 110 to 160 amino acids in their N-terminal part, that can be subdivided into four (or in some cases, three) modules of about 40 residues containing 6 conserved cysteines. Some of the proteins containing this domain are listed below [ (PUBMED:2174582) (PUBMED:15335933) (PUBMED:15335677) ]:
It has been shown [ (PUBMED:8387891) ] that the six cysteines all involved in intrachain disulphide bonds. A schematic representation of the structure of the 40 residue module of these receptors is shown below:
'C': conserved cysteine involved in a disulphide bond. |
GO function: | protein binding (GO:0005515) |
Family alignment: |
There are 32859 TNFR domains in 11619 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Literature (relevant references for this domain)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)