The domain within your query sequence starts at position 883 and ends at position 1055; the E-value for the Tankyrase_bdg_C domain shown below is 1.98e-79.

SEDFSFIEDTEILDSAMYRSRANLGRKRGHRAPAIRPGGTLGLSETADSDTRLFQDSTEP
RASRVPSSDEEVVEEPQSRRTRMSLGTKGLKVNLFPGLSPSALKAKLRSRNRSAEEGEVT
ESKSSQKESSVQRSKSCKVPGLGKPLTLPPKPEKSSGSEGSSPNWLQALKLKK

Tankyrase_bdg_C

Tankyrase binding protein C terminal domain
Tankyrase_bdg_C
SMART accession number:SM01319
Description: This protein domain family is found at the C-terminal end of the Tankyrase binding protein in eukaryotes. The precise function of this protein is still unknown. However, it is known interacts with the enzyme tankyrase, a telomeric poly(ADP-ribose) polymerase, by binding to it. Tankyrin catalyses poly(ADP-ribose) chain formation onto proteins. More specifically, it binds to the ankyrin domain in tankyrase (PMID:11854288). The protein domain is approximately 170 amino acids in length and contains two conserved sequence motifs: FPG and LKA.
Interpro abstract (IPR032764):

This protein domain is found at the C-terminal end of the Tankyrase binding protein in eukaryotes. The precise function of this protein is still unknown. However, it is known that interacts with the enzyme tankyrase, a telomeric poly(ADP-ribose) polymerase, by binding to it. Tankyrin catalyses poly(ADP-ribose) chain formation onto proteins. More specifically, it binds to the ankyrin domain in tankyrase [ (PUBMED:11854288) ]. The protein domain is approximately 170 amino acids in length and contains two conserved sequence motifs: FPG and LKA.

Family alignment:
View or

There are 703 Tankyrase_bdg_C domains in 703 proteins in SMART's nrdb database.

Click on the following links for more information.