The domain within your query sequence starts at position 2752 and ends at position 2793; the E-value for the Tower domain shown below is 2.37e-18.

VEKTVSGLYIFRSEREEEKEALRFAEAQQKKLEALFTKVHTE

Tower

Tower
SMART accession number:SM01341
Description: Members of this family adopt a secondary structure consisting of a pair of long, antiparallel alpha-helices (the stem) that support a three-helix bundle (3HB) at their end. The 3HB contains a helix-turn-helix motif and is similar to the DNA binding domains of the bacterial site-specific recombinases, and of eukaryotic Myb and homeodomain transcription factors. The Tower domain has an important role in the tumor suppressor function of BRCA2, and is essential for appropriate binding of BRCA2 to DNA (PMID:12228710).
Interpro abstract (IPR015205):

This domain adopts a secondary structure consisting of a pair of long, antiparallel alpha-helices (the stem) that support a three-helix bundle (3HB) at their end. The 3HB contains a helix-turn-helix motif and is similar to the DNA binding domains of the bacterial site-specific recombinases, and of eukaryotic Myb and homeodomain transcription factors. The Tower domain has an important role in the tumour suppressor function of BRCA2, and is essential for appropriate binding of BRCA2 to DNA [ (PUBMED:12228710) ].

Family alignment:
View or

There are 392 Tower domains in 392 proteins in SMART's nrdb database.

Click on the following links for more information.