The domain within your query sequence starts at position 464 and ends at position 740; the E-value for the TyrKc domain shown below is 1.67e-148.

All catalytic sites are present in this domain. Check the literature (PubMed 96361355 ) for details.

LVLGKPLGEGCFGQVVRAEAFGMDPSRPDQTSTVAVKMLKDNASDKDLADLVSEMEVMKL
IGRHKNIINLLGVCTQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSF
PALVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDDVMKIADFGLARGVHHIDYYKKT
SNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGH
RMERPPNCPSELYGLMRECWHAAPSQRPTFKQLVEAL

TyrKc

Tyrosine kinase, catalytic domain

• SMART accession number: SM00219
• Description: Phosphotransferases. Tyrosine-specific kinase subfamily.
• Interpro abstract (IPR020635):

  Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity [ (PUBMED:3291115) ]:

  • Serine/threonine-protein kinases
  • Tyrosine-protein kinases
  • Dual specificity protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)

  Protein kinase function is evolutionarily conserved from Escherichia coli to human [ (PUBMED:12471243) ]. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation [ (PUBMED:12368087) ]. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [ (PUBMED:15078142) ], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases [ (PUBMED:15320712) ].

  Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups [ (PUBMED:12471243) ]:

  • Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis [ (PUBMED:19275641) ]. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction [ (PUBMED:16700535) ].
  • Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases [ (PUBMED:15845350) ].

• GO process: protein phosphorylation (GO:0006468)
• GO function: protein tyrosine kinase activity (GO:0004713)

There are 42995 TyrKc domains in 42959 proteins in SMART's nrdb database.

Cellular role (predicted cellular role)

Binding / catalysis: tyrosine-specific phosphotransferase

Literature (relevant references for this domain)

Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.

• Stapleton D, Balan I, Pawson T, Sicheri F
• The crystal structure of an Eph receptor SAM domain reveals a mechanism for modular dimerization.
• Nat Struct Biol. 1999; 6: 44-9

The sterile alpha motif (SAM) domain is a novel protein module of approximately 70 amino acids that is found in a variety of signaling molecules including tyrosine and serine/threonine protein kinases, cytoplasmic scaffolding and adaptor proteins, regulators of lipid metabolism, and GTPases as well as members of the ETS family of transcription factors. The SAM domain can potentially function as a protein interaction module through the ability to homo- and hetero-oligomerize with other SAM domains. This functional property elicits the oncogenic activation of chimeric proteins arising from translocation of the SAM domain of TEL to coding regions of the betaPDGF receptor, Abl, JAK2 protein kinase and the AML1 transcription factor. Here we describe the 2.0 A X-ray crystal structure of a SAM domain homodimer from the intracellular region of the EphA4 receptor tyrosine kinase. The structure reveals a mode of dimerization that we predict is shared amongst the SAM domains of the Eph receptor tyrosine kinases and possibly other SAM domain containing proteins. These data indicate a mechanism through which an independently folding protein module can form homophilic complexes that regulate signaling events at the membrane and in the nucleus.

• Thanos CD, Goodwill KE, Bowie JU
• Oligomeric structure of the human EphB2 receptor SAM domain.
• Science. 1999; 283: 833-6

The sterile alpha motif (SAM) domain is a protein interaction module that is present in diverse signal-transducing proteins. SAM domains are known to form homo- and hetero-oligomers. The crystal structure of the SAM domain from an Eph receptor tyrosine kinase, EphB2, reveals two large interfaces. In one interface, adjacent monomers exchange amino-terminal peptides that insert into a hydrophobic groove on each neighbor. A second interface is composed of the carboxyl-terminal helix and a nearby loop. A possible oligomer, constructed from a combination of these binding modes, may provide a platform for the formation of larger protein complexes.

• Williams JC, Wierenga RK, Saraste M
• Insights into Src kinase functions: structural comparisons.
• Trends Biochem Sci. 1998; 23: 179-84

Recent structures of Src tyrosine kinases reveal complex mechanisms for regulation of enzymatic activity. The regulatory SH3 and SH2 domains bind to the back of the catalytic kinase domain via a linker region that joins the SH2 domain to the catalytic domain. Members of a subgroup of the Src kinase family show distinct features in this linker and in the loops that interact with it. Hydrophobicity of key residues in this region is important for intramolecular regulation. The kinases Abl, Btk and Csk seem to have the same molecular architecture as Src. Structural comparisons between serine/threonine and tyrosine kinases indicate a specific twisting mechanism involving the N- and C-terminal lobes of the catalytic domain. This motion could provide insights into the various mechanisms used to regulate kinase activity.

• Sicheri F, Moarefi I, Kuriyan J
• Crystal structure of the Src family tyrosine kinase Hck.
• Nature. 1997; 385: 602-9

The crystal structure of the haematopoietic cell kinase Hck has been determined at 2.6/2.9 A resolution. Inhibition of enzymatic activity is a consequence of intramolecular interactions of the enzyme's Src-homology domains SH2 and SH3, with concomitant displacement of elements of the catalytic domain. The conformation of the active site has similarities with that of inactive cyclin-dependent protein kinases.

• Xu W, Harrison SC, Eck MJ
• Three-dimensional structure of the tyrosine kinase c-Src.
• Nature. 1997; 385: 595-602

The structure of a large fragment of the c-Src tyrosine kinase, comprising the regulatory and kinase domains and the carboxy-terminal tall, has been determined at 1.7 A resolution in a closed, inactive state. Interactions among domains, stabilized by binding of the phosphorylated tail to the SH2 domain, lock the molecule in a conformation that simultaneously disrupts the kinase active site and sequesters the binding surfaces of the SH2 and SH3 domains. The structure shows how appropriate cellular signals, or transforming mutations in v-Src, could break these interactions to produce an open, active kinase.

• Mohammadi M, Schlessinger J, Hubbard SR
• Structure of the FGF receptor tyrosine kinase domain reveals a novel autoinhibitory mechanism.
• Cell. 1996; 86: 577-87

The crystal structure of the tyrosine kinase domain of fibroblast growth factor receptor 1 (FGFR1K) has been determined in its unliganded form to 2.0 angstroms resolution and in complex with with an ATP analog to 2.3 angstrosms A resolution. Several features distinguish the structure of FGFR1K from that of the tyrosine kinase domain of the insulin receptor. Residues in the activation loop of FGFR1K appear to interfere with substrate peptide binding but not with ATP binding, revealing a second and perhaps more general autoinhibitory mechanism for receptor tyrosine kinases. In addition, a dimeric form of FGFR1K observed in the crystal structure may provide insights into the molecular mechanisms by which FGF receptors are activated. Finally, the structure provides a basis for rationalizing the effects of kinase mutations in FGF receptors that lead to developmental disorders in nematodes and humans.

• Hanks SK, Hunter T
• Protein kinases 6. The eukaryotic protein kinase superfamily: kinase (catalytic) domain structure and classification.
• FASEB J. 1995; 9: 576-96

The eukaryotic protein kinases make up a large superfamily of homologous proteins. They are related by virtue of their kinase domains (also known as catalytic domains), which consist of approximately 250-300 amino acid residues. The kinase domains that define this group of enzymes contain 12 conserved subdomains that fold into a common catalytic core structure, as revealed by the 3-dimensional structures of several protein-serine kinases. There are two main subdivisions within the superfamily: the protein-serine/threonine kinases and the protein-tyrosine kinases. A classification scheme can be founded on a kinase domain phylogeny, which reveals families of enzymes that have related substrate specificities and modes of regulation.

• Liu D, Bienkowska J, Petosa C, Collier RJ, Fu H, Liddington R
• Crystal structure of the zeta isoform of the 14-3-3 protein.
• Nature. 1995; 376: 191-4

The 14-3-3 family of proteins have recently been identified as regulatory elements in intracellular signalling pathways: 14-3-3 proteins bind to oncogene and proto-oncogene products, including c-Raf-1 (refs 2-5), c-Bcr (ref. 6) and polyomavirus middle-T antigen; overexpression of 14-3-3 activates Raf kinase in yeast and induces meiotic maturation in Xenopus oocytes. Here we report the crystal structure of the major isoform of mammalian 14-3-3 proteins at 2.9 A resolution. Each subunit of the dimeric protein consists of a bundle of nine antiparallel helices that form a palisade around an amphipathic groove. The groove is large enough to accommodate a tenth helix, and we propose that binding to an amphipathic helix represents a general mechanism for the interaction of 14-3-3 with diverse cellular proteins. The residues in the dimer interface and the putative ligand-binding surface are invariant among vertebrates, yeast and plants, suggesting a conservation of structure and function throughout the 14-3-3 family.

• Owen DJ, Noble ME, Garman EF, Papageorgiou AC, Johnson LN
• Two structures of the catalytic domain of phosphorylase kinase: an active protein kinase complexed with substrate analogue and product.
• Structure. 1995; 3: 467-82

BACKGROUND: Control of intracellular events by protein phosphorylation is promoted by specific protein kinases. All the known protein kinase possess a common structure that defines a catalytically competent entity termed the 'kinase catalytic core'. Within this common structural framework each kinase displays its own unique substrate specificity, and a regulatory mechanism that may be modulated by association with other proteins. Structural studies of phosphorylase kinase (Phk), the major substrate of which is glycogen phosphorylase, may be expected to shed light on its regulation. RESULTS: We report two crystal structures of the catalytic core (residues 1-298; Phk gamma trnc) of the gamma-subunit of rabbit muscle phosphorylase kinase: the binary complex with Mn2+/beta-gamma-imidoadenosine 5'-triphosphate (AMPPNP) to a resolution of 2.6 A and the binary complex with Mg2+/ADP to a resolution of 3.0 A. The structures were solved by molecular replacement using the cAMP-dependent protein kinase (cAPK) as a model. CONCLUSIONS: The overall structure of Phk gamma trnc is similar to that of the catalytic core of other protein kinases. It consists of two domians joined on one edge by a 'hinge', with the catalytic site located in the cleft between the domains. Phk gamma trnc is constitutively active, and lacks the need for an activatory phosphorylation event that is essential for many kinases. The structure exhibits an essentially 'closed' conformation of the domains which is similar to that of cAPK complexed with substrates. The phosphorylated residue that is located at the domain interface in many protein kinases and that is believed to stabilize an active conformation is substituted by a glutamate in Phk gamma trnc. The glutamate, in a similar manner to the phosphorylated residue in other protein kinases, interacts with an arginine adjacent to the catalytic aspartate but does not participate in interdomain contacts. The interactions between the enzyme and the nucleotide product of its activity, Mg2+/ADP, explain the inhibitory properties of the nucleotides that are observed in kinetic studies.

• Hubbard SR, Wei L, Ellis L, Hendrickson WA
• Crystal structure of the tyrosine kinase domain of the human insulin receptor.
• Nature. 1994; 372: 746-54

The X-ray crystal structure of the tyrosine kinase domain of the human insulin receptor has been determined by multiwavelength anomalous diffraction phasing and refined to 2.1 A resolution. The structure reveals the determinants of substrate preference for tyrosine rather than serine or threonine and a novel autoinhibition mechanism whereby one of the tyrosines that is autophosphorylated in response to insulin, Tyr 1,162, is bound in the active site.

• Taylor SS, Radzio-Andzelm E
• Three protein kinase structures define a common motif.
• Structure. 1994; 2: 345-55

Structural comparisons between cAMP-dependent protein kinase, cyclin-dependent kinase 2 and mitogen-activated protein kinase reveal which features are common to the protein kinase family and which are enzyme-specific.

• Knighton DR et al.
• Crystal structure of the catalytic subunit of cyclic adenosine monophosphate-dependent protein kinase.
• Science. 1991; 253: 407-14

The crystal structure of the catalytic subunit of cyclic adenosine monophosphate-dependent protein kinase complexed with a 20-amino acid substrate analog inhibitor has been solved and partially refined at 2.7 A resolution to an R factor of 0.212. The magnesium adenosine triphosphate (MgATP) binding site was located by difference Fourier synthesis. The enzyme structure is bilobal with a deep cleft between the lobes. The cleft is filled by MgATP and a portion of the inhibitor peptide. The smaller lobe, consisting mostly of amino-terminal sequence, is associated with nucleotide binding, and its largely antiparallel beta sheet architecture constitutes an unusual nucleotide binding motif. The larger lobe is dominated by helical structure with a single beta sheet at the domain interface. This lobe is primarily involved in peptide binding and catalysis. Residues 40 through 280 constitute a conserved catalytic core that is shared by more than 100 protein kinases. Most of the invariant amino acids in this conserved catalytic core are clustered at the sites of nucleotide binding and catalysis.

Disease (disease genes where sequence variants are found in this domain)

SwissProt sequences and OMIM curated human diseases associated with missense mutations within the TyrKc domain.

Protein	Disease
Phosphorylase b kinase gamma catalytic chain, liver/testis isoform (P15735) (SMART)	OMIM:172471: Glycogenosis, hepatic, autosomal
Protein kinase C gamma type (P05129) (SMART)	OMIM:176980: PROTEIN KINASE C, GAMMA; PRKCG
High affinity nerve growth factor receptor (P04629) (SMART)	OMIM:191315: Insensitivity to pain, congenital, with anhidrosis OMIM:256800: Medullary thyroid carcinoma, familial OMIM:155240:
Serine/threonine-protein kinase STK11 (Q15831) (SMART)	OMIM:602216: Peutz-Jeghers syndrome OMIM:175200:
Ribosomal protein S6 kinase alpha-3 (P51812) (SMART)	OMIM:300075: Coffin-Lowry syndrome OMIM:303600: Mental retardation, X-linked nonspecific, type 19
Rhodopsin kinase (Q15835) (SMART)	OMIM:180381: Oguchi disease-2 OMIM:258100:
Proto-oncogene tyrosine-protein kinase receptor Ret (P07949) (SMART)	OMIM:164761: Multiple endocrine neoplasia IIA OMIM:171400: Medullary thyroid carcinoma OMIM:155240: Multiple endocrine neoplasia IIB OMIM:162300: Hirschsprung disease OMIM:142623: OMIM:188550: Thyroid papillary carcinoma
Hepatocyte growth factor receptor (P08581) (SMART)	OMIM:164860: Renal cell carcinoma, papillary, familial and sporadic OMIM:605074: Hepatocellular carcinoma, childhood type OMIM:114550:
Angiopoietin-1 receptor (Q02763) (SMART)	OMIM:600221: Venous malformations, multiple cutaneous and mucosal OMIM:600195:
Tyrosine-protein kinase ZAP-70 (P43403) (SMART)	OMIM:176947: Selective T-cell defect
Retinal guanylyl cyclase 1 (Q02846) (SMART)	OMIM:601777: Cone dystrophy, progressive OMIM:600179: Leber congenital amaurosis, type I OMIM:204000: Cone-rod dystrophy 6 OMIM:601777:
TGF-beta receptor type-2 (P37173) (SMART)	OMIM:190182: Colon cancer ; Colorectal cancer, hereditary nonpolyposis, type 6 OMIM:114500: Esophageal cancer OMIM:133239:
Mast/stem cell growth factor receptor Kit (P10721) (SMART)	OMIM:164920: Piebaldism ; Mast cell leukemia ; Mastocytosis with associated hematologic disorder ; Germ cell tumors OMIM:273300:
Insulin receptor (P06213) (SMART)	OMIM:147670: Leprechaunism OMIM:246200: Rabson-Mendenhall syndrome OMIM:262190: Diabetes mellitus, insulin-resistant, with acanthosis nigricans
Cyclin-dependent kinase 4 (P11802) (SMART)	OMIM:123829: Melanoma
Fibroblast growth factor receptor 3 (P22607) (SMART)	OMIM:134934: Achondroplasia OMIM:100800: Hypochondroplasia OMIM:146000: Thanatophoric dysplasia, types I and II OMIM:187600: Crouzon syndrome with acanthosis nigricans ; Muencke syndrome OMIM:602849: OMIM:600593: Craniosynostosis, Adelaide type
Serine/threonine-protein kinase receptor R3 (P37023) (SMART)	OMIM:601284: Hereditary hemorrhagic telangiectasia-2 OMIM:600376:
Tyrosine-protein kinase BTK (Q06187) (SMART)	OMIM:300300: Agammaglobulinemia, type 1, X-linked ; ?XLA and isolated growth hormone deficiency OMIM:307200:

Metabolism (metabolic pathways involving proteins which contain this domain)

% proteins involved	KEGG pathway ID	Description
8.37	map04360	Axon guidance
7.00	map04510	Focal adhesion
5.70	map04060	Cytokine-cytokine receptor interaction
5.49	map04520	Adherens junction
5.42	map04810	Regulation of actin cytoskeleton
4.39	map04012	ErbB signaling pathway
4.32	map05215	Prostate cancer
3.77	map04010	MAPK signaling pathway
3.64	map05218	Melanoma
3.50	map04020	Calcium signaling pathway
3.29	map05120	Epithelial cell signaling in Helicobacter pylori infection
2.95	map05210	Colorectal cancer
2.75	map04650	Natural killer cell mediated cytotoxicity
2.54	map04660	T cell receptor signaling pathway
2.33	map05214	Glioma
2.33	map04664	Fc epsilon RI signaling pathway
2.26	map04670	Leukocyte transendothelial migration
2.26	map04540	Gap junction
1.99	map04630	Jak-STAT signaling pathway
1.99	map04920	Adipocytokine signaling pathway
1.92	map04912	GnRH signaling pathway
1.85	map04370	VEGF signaling pathway
1.78	map04662	B cell receptor signaling pathway
1.65	map05219	Bladder cancer
1.65	map04640	Hematopoietic cell lineage
1.37	map04730	Long-term depression
1.30	map04530	Tight junction
1.17	map05213	Endometrial cancer
1.17	map05212	Pancreatic cancer
1.17	map05223	Non-small cell lung cancer
1.10	map05221	Acute myeloid leukemia
0.96	map05216	Thyroid cancer
0.69	map05220	Chronic myeloid leukemia
0.69	map04110	Cell cycle
0.69	map04916	Melanogenesis
0.69	map04320	Dorso-ventral axis formation
0.69	map04914	Progesterone-mediated oocyte maturation
0.62	map05222	Small cell lung cancer
0.62	map05211	Renal cell carcinoma
0.48	map05050	Dentatorubropallidoluysian atrophy (DRPLA)
0.48	map04210	Apoptosis
0.48	map04910	Insulin signaling pathway
0.48	map04930	Type II diabetes mellitus

This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with TyrKc domain which could be assigned to a KEGG orthologous group, and not all proteins containing TyrKc domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.

Structure (3D structures containing this domain)

3D Structures of TyrKc domains in PDB

PDB code	Title
1ad5	SRC FAMILY KINASE HCK-AMP-PNP COMPLEX
1agw	CRYSTAL STRUCTURE OF THE TYROSINE KINASE DOMAIN OF FIBROBLAST GROWTH FACTOR RECEPTOR 1 IN COMPLEX WITH SU4984 INHIBITOR
1byg	KINASE DOMAIN OF HUMAN C-TERMINAL SRC KINASE (CSK) IN COMPLEX WITH INHIBITOR STAUROSPORINE
1fgi	CRYSTAL STRUCTURE OF THE TYROSINE KINASE DOMAIN OF FIBROBLAST GROWTH FACTOR RECEPTOR 1 IN COMPLEX WITH SU5402 INHIBITOR
1fgk	CRYSTAL STRUCTURE OF THE TYROSINE KINASE DOMAIN OF FIBROBLAST GROWTH FACTOR RECEPTOR 1
1fmk	CRYSTAL STRUCTURE OF HUMAN TYROSINE-PROTEIN KINASE C-SRC
1fpu	CRYSTAL STRUCTURE OF ABL KINASE DOMAIN IN COMPLEX WITH A SMALL MOLECULE INHIBITOR
1fvr	TIE2 KINASE DOMAIN
1gag	CRYSTAL STRUCTURE OF THE INSULIN RECEPTOR KINASE IN COMPLEX WITH A BISUBSTRATE INHIBITOR
1gjo	The FGFr2 tyrosine kinase domain
1i44	CRYSTALLOGRAPHIC STUDIES OF AN ACTIVATION LOOP MUTANT OF THE INSULIN RECEPTOR TYROSINE KINASE
1iep	CRYSTAL STRUCTURE OF THE C-ABL KINASE DOMAIN IN COMPLEX WITH STI-571.
1ir3	PHOSPHORYLATED INSULIN RECEPTOR TYROSINE KINASE IN COMPLEX WITH PEPTIDE SUBSTRATE AND ATP ANALOG
1irk	CRYSTAL STRUCTURE OF THE TYROSINE KINASE DOMAIN OF THE HUMAN INSULIN RECEPTOR
1jpa	Crystal Structure of unphosphorylated EphB2 receptor tyrosine kinase and juxtamembrane region
1jqh	IGF-1 receptor kinase domain
1k2p	Crystal structure of Bruton's tyrosine kinase domain
1k3a	Structure of the Insulin-like Growth Factor 1 Receptor Kinase
1k9a	Crystal structure analysis of full-length carboxyl-terminal Src kinase at 2.5 A resolution
1ksw	Structure of Human c-Src Tyrosine Kinase (Thr338Gly Mutant) in Complex with N6-benzyl ADP
1luf	Crystal Structure of the MuSK Tyrosine Kinase: Insights into Receptor Autoregulation
1m14	Tyrosine Kinase Domain from Epidermal Growth Factor Receptor
1m17	Epidermal Growth Factor Receptor tyrosine kinase domain with 4-anilinoquinazoline inhibitor erlotinib
1m52	Crystal Structure of the c-Abl Kinase domain in complex with PD173955
1m7n	Crystal Structure of Unactivated APO Insulin-like Growth Factor-1 Receptor Kinase Domain
1mp8	Crystal structure of Focal Adhesion Kinase (FAK)
1mqb	Crystal Structure of Ephrin A2 (ephA2) Receptor Protein Kinase
1oec	FGFr2 kinase domain
1opj	Structural basis for the auto-inhibition of c-Abl tyrosine kinase
1opk	Structural basis for the auto-inhibition of c-Abl tyrosine kinase
1opl	Structural basis for the auto-inhibition of c-Abl tyrosine kinase
1p14	Crystal structure of a catalytic-loop mutant of the insulin receptor tyrosine kinase
1p4o	Structure of Apo unactivated IGF-1R KInase domain at 1.5A resolution.
1pkg	Structure of a c-Kit Kinase Product Complex
1qcf	CRYSTAL STRUCTURE OF HCK IN COMPLEX WITH A SRC FAMILY-SELECTIVE TYROSINE KINASE INHIBITOR
1qpc	STRUCTURAL ANALYSIS OF THE LYMPHOCYTE-SPECIFIC KINASE LCK IN COMPLEX WITH NON-SELECTIVE AND SRC FAMILY SELECTIVE KINASE INHIBITORS
1qpd	STRUCTURAL ANALYSIS OF THE LYMPHOCYTE-SPECIFIC KINASE LCK IN COMPLEX WITH NON-SELECTIVE AND SRC FAMILY SELECTIVE KINASE INHIBITORS
1qpe	STRUCTURAL ANALYSIS OF THE LYMPHOCYTE-SPECIFIC KINASE LCK IN COMPLEX WITH NON-SELECTIVE AND SRC FAMILY SELECTIVE KINASE INHIBITORS
1qpj	CRYSTAL STRUCTURE OF THE LYMPHOCYTE-SPECIFIC KINASE LCK IN COMPLEX WITH STAUROSPORINE.
1r0p	Crystal structure of the tyrosine kinase domain of the hepatocyte growth factor receptor c-Met in complex with the microbial alkaloid K-252a
1r1w	CRYSTAL STRUCTURE OF THE TYROSINE KINASE DOMAIN OF THE HEPATOCYTE GROWTH FACTOR RECEPTOR C-MET
1rjb	Crystal Structure of FLT3
1rqq	Crystal Structure of the Insulin Receptor Kinase in Complex with the SH2 Domain of APS
1sm2	Crystal structure of the phosphorylated Interleukin-2 tyrosine kinase catalytic domain
1snu	CRYSTAL STRUCTURE OF THE UNPHOSPHORYLATED INTERLEUKIN-2 TYROSINE KINASE CATALYTIC DOMAIN
1snx	CRYSTAL STRUCTURE OF APO INTERLEUKIN-2 TYROSINE KINASE CATALYTIC DOMAIN
1t45	STRUCTURAL BASIS FOR THE AUTOINHIBITION AND STI-571 INHIBITION OF C-KIT TYROSINE KINASE
1t46	STRUCTURAL BASIS FOR THE AUTOINHIBITION AND STI-571 INHIBITION OF C-KIT TYROSINE KINASE
1u46	Crystal Structure of the Unphosphorylated Kinase Domain of the Tyrosine Kinase ACK1
1u4d	Structure of the ACK1 Kinase Domain bound to Debromohymenialdisine
1u54	Crystal Structures of the Phosphorylated and Unphosphorylated Kinase Domains of the CDC42-associated Tyrosine Kinase ACK1 bound to AMP-PCP
1u59	Crystal Structure of the ZAP-70 Kinase Domain in Complex with Staurosporine
1vr2	HUMAN VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2 (KDR) KINASE DOMAIN
1xba	Crystal structure of apo syk tyrosine kinase domain
1xbb	Crystal structure of the syk tyrosine kinase domain with Gleevec
1xbc	Crystal structure of the syk tyrosine kinase domain with Staurosporin
1xkk	EGFR kinase domain complexed with a quinazoline inhibitor- GW572016
1y57	Structure of unphosphorylated c-Src in complex with an inhibitor
1y6a	Crystal structure of VEGFR2 in complex with a 2-anilino-5-aryl-oxazole inhibitor
1y6b	Crystal structure of VEGFR2 in complex with a 2-anilino-5-aryl-oxazole inhibitor
1yi6	C-term tail segment of human tyrosine kinase (258-533)
1yoj	Crystal structure of Src kinase domain
1yol	Crystal structure of Src kinase domain in complex with CGP77675
1yom	Crystal structure of Src kinase domain in complex with Purvalanol A
1yvj	Crystal structure of the Jak3 kinase domain in complex with a staurosporine analogue
1ywn	Vegfr2 in complex with a novel 4-amino-furo[2,3-d]pyrimidine
2auh	Crystal structure of the Grb14 BPS region in complex with the insulin receptor tyrosine kinase
2b4s	Crystal structure of a complex between PTP1B and the insulin receptor tyrosine kinase
2b7a	The structural basis of Janus Kinase 2 inhibition by a potent and specific pan-Janus kinase inhibitor
2bdf	Src kinase in complex with inhibitor AP23451
2bdj	Src kinase in complex with inhibitor AP23464
2c0i	Src family kinase Hck with bound inhibitor A-420983
2c0o	Src family kinase Hck with bound inhibitor A-770041
2c0t	Src family kinase Hck with bound inhibitor A-641359
2dq7	Crystal Structure of Fyn kinase domain complexed with staurosporine
2e2b	Crystal structure of the c-Abl kinase domain in complex with INNO-406
2eb2	Crystal structure of mutated EGFR kinase domain (G719S)
2eb3	Crystal structure of mutated EGFR kinase domain (L858R) in complex with AMPPNP
2etm	Crystal Structure of Focal Adhesion Kinase Domain Complexed with 7H-Pyrrolo [2,3-d] pyrimidine Derivative
2f4j	Structure of the Kinase Domain of an Imatinib-Resistant Abl Mutant in Complex with the Aurora Kinase Inhibitor VX-680
2fgi	CRYSTAL STRUCTURE OF THE TYROSINE KINASE DOMAIN OF FGF RECEPTOR 1 IN COMPLEX WITH INHIBITOR PD173074
2fo0	Organization of the SH3-SH2 Unit in Active and Inactive Forms of the c-Abl Tyrosine Kinase
2g15	Structural Characterization of autoinhibited c-Met kinase
2g1t	A Src-like Inactive Conformation in the Abl Tyrosine Kinase Domain
2g2f	A Src-like Inactive Conformation in the Abl Tyrosine Kinase Domain
2g2h	A Src-like Inactive Conformation in the Abl Tyrosine Kinase Domain
2g2i	A Src-like Inactive Conformation in the Abl Tyrosine Kinase Domain
2gqg	X-ray Crystal Structure of Dasatinib (BMS-354825) Bound to Activated ABL Kinase Domain
2gs2	Crystal Structure of the active EGFR kinase domain
2gs6	Crystal Structure of the active EGFR kinase domain in complex with an ATP analog-peptide conjugate
2gs7	Crystal Structure of the inactive EGFR kinase domain in complex with AMP-PNP
2gsf	The Human Epha3 Receptor Tyrosine Kinase and Juxtamembrane Region
2h8h	Src kinase in complex with a quinazoline inhibitor
2hck	SRC FAMILY KINASE HCK-QUERCETIN COMPLEX
2hel	Crystal structure of a mutant EphA4 kinase domain (Y742A)
2hen	Crystal Structure of the EphB2 Receptor Kinase domain in complex with ADP
2hiw	Crystal Structure of Inactive Conformation Abl Kinase Catalytic Domain Complexed with Type II Inhibitor
2hk5	Hck Kinase in Complex with Lck targetted Inhibitor PG-1009247
2hwo	Crystal structure of Src kinase domain in complex with covalent inhibitor
2hwp	Crystal structure of Src kinase domain in complex with covalent inhibitor PD168393
2hyy	Human Abl kinase domain in complex with imatinib (STI571, Glivec)
2hz0	Abl kinase domain in complex with NVP-AEG082
2hz4	Abl kinase domain unligated and in complex with tetrahydrostaurosporine
2hzi	Abl kinase domain in complex with PD180970
2hzn	Abl kinase domain in complex with NVP-AFG210
2i0v	c-FMS tyrosine kinase in complex with a quinolone inhibitor
2i0y	cFMS tyrosine kinase (FGF KID) in complex with an arylamide inhibitor
2i1m	cFMS tyrosine kinase (tie2 KID) in complex with an arylamide inhibitor
2ijm	Crystal Structure of Focal Adhesion Kinase Domain with 2 molecules in the Asymmetric Unit Complexed with ADP and ATP
2itn	Crystal structure of EGFR kinase domain G719S mutation in complex with AMP-PNP
2ito	Crystal structure of EGFR kinase domain G719S mutation in complex with Iressa
2itp	Crystal structure of EGFR kinase domain G719S mutation in complex with AEE788
2itq	Crystal structure of EGFR kinase domain G719S mutation in complex with AFN941
2itt	Crystal structure of EGFR kinase domain L858R mutation in complex with AEE788
2itu	Crystal structure of EGFR kinase domain L858R mutation in complex with AFN941
2itv	Crystal structure of EGFR kinase domain L858R mutation in complex with AMP-PNP
2itw	Crystal structure of EGFR kinase domain in complex with AFN941
2itx	Crystal structure of EGFR kinase domain in complex with AMP-PNP
2ity	Crystal structure of EGFR kinase domain in complex with Iressa
2itz	Crystal structure of EGFR kinase domain L858R mutation in complex with Iressa
2ivs	Crystal structure of non-phosphorylated RET tyrosine kinase domain
2ivt	Crystal structure of phosphorylated RET tyrosine kinase domain
2ivu	Crystal structure of phosphorylated RET tyrosine kinase domain complexed with the inhibitor ZD6474
2ivv	Crystal structure of phosphorylated RET tyrosine kinase domain complexed with the inhibitor PP1
2j0j	Crystal structure of a fragment of focal adhesion kinase containing the FERM and kinase domains.
2j0k	Crystal structure of a fragment of focal adhesion kinase containing the FERM and kinase domains.
2j0l	Crystal structure of a the active conformation of the kinase domain of focal adhesion kinase with a phosphorylated activation loop.
2j0m	Crystal structure a two-chain complex between the FERM and kinase domains of focal adhesion kinase.
2j5e	Crystal structure of EGFR kinase domain in complex with an irreversible inhibitor 13-jab
2j5f	Crystal structure of EGFR kinase domain in complex with an irreversible inhibitor 34-jab
2j6m	Crystal structure of EGFR kinase domain in complex with AEE788
2jit	Crystal structure of EGFR kinase domain T790M mutation
2jiu	Crystal structure of EGFR kinase domain T790M mutation in complex with AEE788
2jiv	Crystal structure of EGFR kinase domain T790M mutation in compex with HKI-272
2jkk	Focal Adhesion Kinase catalytic domain in complex with bis-anilino pyrimidine inhibitor
2jkm	Focal Adhesion Kinase catalytic domain in complex with bis-anilino pyrimidine inhibitor
2jko	Focal Adhesion Kinase catalytic domain in complex with bis-anilino pyrimidine inhibitor
2jkq	Focal Adhesion Kinase catalytic domain in complex with bis-anilino pyrimidine inhibitor
2of2	crystal structure of furanopyrimidine 8 bound to lck
2of4	crystal structure of furanopyrimidine 1 bound to lck
2ofu	x-ray crystal structure of 2-aminopyrimidine carbamate 43 bound to Lck
2ofv	crystal structure of aminoquinazoline 1 bound to Lck
2og8	crystal structure of aminoquinazoline 36 bound to Lck
2ogv	Crystal Structure of the Autoinhibited Human c-Fms Kinase Domain
2oh4	Crystal structure of Vegfr2 with a benzimidazole-urea inhibitor
2oiq	Crystal Structure of chicken c-Src kinase domain in complex with the cancer drug imatinib.
2oj9	Structure of IGF-1R kinase domain complexed with a benzimidazole inhibitor
2oo8	Synthesis, Structural Analysis, and SAR Studies of Triazine Derivatives as Potent, Selective Tie-2 Inhibitors
2osc	Synthesis, Structural Analysis, and SAR Studies of Triazine Derivatives as Potent, Selective Tie-2 Inhibitors
2ozo	Autoinhibited intact human ZAP-70
2p0c	Catalytic Domain of the Proto-oncogene Tyrosine-protein Kinase MER
2p2h	Crystal structure of the VEGFR2 kinase domain in complex with a pyridinyl-triazine inhibitor
2p2i	Crystal structure of the VEGFR2 kinase domain in complex with a nicotinamide inhibitor
2p4i	Evolution of a highly Selective and Potent 2-(Pyridin-2-yl)-1,3,5-triazine Tie-2 Kinase Inhibitor
2pl0	LCK bound to imatinib
2psq	Crystal Structure of Unphosphorylated Unactivated Wild Type FGF Receptor 2 (FGFR2) Kinase Domain
2ptk	CHICKEN SRC TYROSINE KINASE
2pvf	Crystal Structure of Tyrosine Phosphorylated Activated FGF Receptor 2 (FGFR2) Kinase Domain in Complex with ATP Analog and Substrate Peptide
2pvy	Crystal Strucure of FGF Receptor 2 (FGFR2) Kinase Domain Harboring the Pathogenic K659N Mutation Responsible for an Unclassified Craniosynostosis Syndrome.
2pwl	Crystal Strucure of FGF Receptor 2 (FGFR2) Kinase Domain Harboring the Pathogenic N549H Mutation Responsible for Crouzon Syndrome.
2py3	Crystal Strucure of FGF Receptor 2 (FGFR2) Kinase Domain Harboring the Pathogenic E565G Mutation Responsible for Pfeiffer Syndrome
2pz5	Crystal Strucure of FGF Receptor 2 (FGFR2) Kinase Domain Harboring the Pathogenic N549T Mutation Responsible for Pfeiffer Syndrome
2pzp	Crystal Strucure of FGF Receptor 2 (FGFR2) Kinase Domain Harboring the Pathogenic K526E Mutation Responsible for Crouzon Syndrome
2pzr	Crystal Strucure of FGF Receptor 2 (FGFR2) Kinase Domain Harboring the Pathogenic K641R Mutation Responsible for Pfeiffer Syndrome
2q0b	Crystal Strucure of FGF Receptor 2 (FGFR2) Kinase Domain Harboring the Pathogenic E565A Mutation Responsible for Pfeiffer Syndrome
2qi8	Crystal structure of drug resistant SRC kinase domain
2qlq	Crystal structure of SRC kinase domain with covalent inhibitor RL3
2qo2	Human EphA3 kinase and juxtamembrane region, dephosphorylated, apo structure
2qo7	Human EphA3 kinase and juxtamembrane region, dephosphorylated, AMP-PNP bound
2qo9	Human EphA3 kinase and juxtamembrane region, phosphorylated, AMP-PNP bound
2qob	Human EphA3 kinase domain, base structure
2qoc	Human EphA3 kinase domain, phosphorylated, AMP-PNP bound structure
2qod	Human EphA3 kinase and juxtamembrane region, Y602F mutant
2qof	Human EphA3 kinase and juxtamembrane region, Y596F mutant
2qoh	Crystal Structure of Abl kinase bound with PPY-A
2qoi	Human EphA3 kinase and juxtamembrane region, Y596F:Y602F double mutant
2qok	Human EphA3 kinase and juxtamembrane region, Y596F:Y602F:S768A triple mutant
2qol	Human EphA3 kinase and juxtamembrane region, Y596:Y602:S768G triple mutant
2qon	Human EphA3 kinase and juxtamembrane region, Y596F:Y602F:Y742A triple mutant
2qoo	Human EphA3 kinase and juxtamembrane region, Y596F:Y602F:Y742F triple mutant
2qoq	Human EphA3 kinase and juxtamembrane region, base, AMP-PNP bound structure
2qq7	Crystal structure of drug resistant SRC kinase domain with irreversible inhibitor
2qu5	Crystal structure of the VEGFR2 kinase domain in complex with a benzimidazole inhibitor
2qu6	Crystal structure of the VEGFR2 kinase domain in complex with a benzoxazole inhibitor
2r2p	Kinase domain of human ephrin type-A receptor 5 (EphA5)
2r4b	ErbB4 kinase domain complexed with a thienopyrimidine inhibitor
2rei	Kinase domain of human ephrin type-A receptor 7 (Epha7)
2rf9	Crystal structure of the complex between the EGFR kinase domain and a Mig6 peptide
2rfd	Crystal structure of the complex between the EGFR kinase domain and a Mig6 peptide
2rfe	Crystal structure of the complex between the EGFR kinase domain and a Mig6 peptide
2rfn	x-ray structure of c-Met with inhibitor.
2rfs	X-ray structure of SU11274 bound to c-Met
2rgp	Structure of EGFR in complex with hydrazone, a potent dual inhibitor
2rl5	Crystal structure of the VEGFR2 kinase domain in complex with a 2,3-dihydro-1,4-benzoxazine inhibitor
2src	CRYSTAL STRUCTURE OF HUMAN TYROSINE-PROTEIN KINASE C-SRC, IN COMPLEX WITH AMP-PNP
2v7a	Crystal structure of the T315I Abl mutant in complex with the inhibitor PHA-739358
2vwu	ephB4 kinase domain inhibitor complex
2vwv	ephB4 kinase domain inhibitor complex
2vww	ephB4 kinase domain inhibitor complex
2vwx	ephB4 kinase domain inhibitor complex
2vwy	ephB4 kinase domain inhibitor complex
2vwz	ephB4 kinase domain inhibitor complex
2vx0	ephB4 kinase domain inhibitor complex
2vx1	ephB4 kinase domain inhibitor complex
2w1i	Structure determination of Aurora Kinase in complex with inhibitor
2wd1	Human c-Met Kinase in complex with azaindole inhibitor
2wgj	X-ray Structure of PF-02341066 bound to the kinase domain of c-Met
2wkm	X-ray Structure of PHA-00665752 bound to the kinase domain of c-Met
2wqb	Structure of the Tie2 kinase domain in complex with a thiazolopyrimidine inhibitor
2x2k	Crystal Structure of phosphorylated RET tyrosine kinase domain with inhibitor
2x2l	Crystal Structure of phosphorylated RET tyrosine kinase domain with inhibitor
2x2m	Crystal Structure of phosphorylated RET tyrosine kinase domain with inhibitor
2x9f	ephB4 kinase domain inhibitor complex
2xa4	Inhibitors of Jak2 Kinase domain
2xb7	Structure of Human Anaplastic Lymphoma Kinase in complex with NVP- TAE684
2xba	Structure of Human Anaplastic Lymphoma Kinase in complex with PHA- E429
2xir	Crystal structure of the VEGFR2 kinase domain in complex with PF- 00337210 (N,2-dimethyl-6-(7-(2-morpholinoethoxy)quinolin-4-yloxy) benzofuran-3-carboxamide)
2xp2	Structure of the Human Anaplastic Lymphoma Kinase in Complex with Crizotinib (PF-02341066)
2xvd	ephB4 kinase domain inhibitor complex
2xyn	HUMAN ABL2 IN COMPLEX WITH AURORA KINASE INHIBITOR VX-680
2xyu	Crystal structure of EphA4 kinase domain in complex with VUF 12058
2y6m	Crystal structure of EphA4 kinase domain
2y6o	Crystal structure of EphA4 kinase domain in complex with Dasatinib.
2yfx	Structure of L1196M Mutant Anaplastic Lymphoma Kinase in Complex with Crizotinib
2yhv	Structure of L1196M Mutant Anaplastic Lymphoma Kinase
2yjr	Structure of F1174L Mutant Anaplastic Lymphoma Kinase
2yjs	Structure of C1156Y Mutant Anaplastic Lymphoma Kinase
2yn8	ephB4 kinase domain inhibitor complex
2z60	Crystal Structure of the T315I Mutant of Abl kinase bound with PPY-A
2z8c	Phosphorylated insulin receptor tyrosine kinase in complex with (4-{[5-carbamoyl-4-(3-methylanilino)pyrimidin-2-yl]amino}phenyl)acetic acid
2zm1	Crystal structure of imidazo pyrazin 1 bound to the kinase domain of human LCK, (auto-phosphorylated on TYR394)
2zm3	Complex Structure of Insulin-like Growth Factor Receptor and Isoquinolinedione Inhibitor
2zm4	Crystal structure of imidazo quinoxaline 1 bound to the kinase domain of human LCK, activated form (auto-phosphorylated on TYR394)
2zv7	Lyn Tyrosine Kinase Domain, apo form
2zv8	Lyn Tyrosine Kinase Domain-AMP-PNP complex
2zv9	Lyn Tyrosine Kinase Domain-PP2 complex
2zva	Lyn Tyrosine Kinase Domain-Dasatinib complex
2zyb	Crystal structure of phenylimidazo pyrazin 2 bound to the kinase domain of human LCK, (auto-phosphorylated on TYR394)
3a4o	Lyn kinase domain
3a4p	human c-MET kinase domain complexed with 6-benzyloxyquinoline inhibitor
3ac1	Crystal structure of pyrazin derivative bound to the kinase domain of Human LCK, (Auto-phosphorylated on TYR394)
3ac2	Crystal structure of pyrazolo pyrimidine derivative bound to the kinase domain of human LCK, (auto-phosphorylated on TYR394)
3ac3	Crystal structure of pyrazolo pyrimidine derivative bound to the kinase domain of human LCK, (auto-phosphorylated on TYR394)
3ac4	Crystal structure of triazolo pyrimidine derivative bound to the kinase domain of human LCK, (auto-phosphorylated on TYR394)
3ac5	Crystal structure of triazolo pyrimidine derivative bound to the kinase domain of human LCK, (auto-phosphorylated on TYR394)
3ac8	Crystal structure of pyrazolo pyrimidine derivative bound to the kinase domain of human LCK, (auto-phosphorylated on TYR394)
3acj	Crystal structure of imidazo pyrimidine derivative bound to the kinase domain of human LCK, (Auto-phosphorylated on TYR394)
3ack	Crystal structure of Pyrrolo pyrazine derivative bound to the kinase domain of human LCK, (auto-phosphorylated on TYR394)
3ad4	Crystal Structure of Methoxy Benzofuran Derivative bound to the Kinase domain of human LCK, (auto-phosphorylated on TYR394)
3ad5	Crystal structure of Triazolone derivative bound to the kinase domain of human LCK, (auto-phosphorylated on TYR394)
3ad6	Crystal structure of Pyrazolo pyrimidine derivative bound to the kinase domain of human LCK, (auto-phosphorylated on TYR394)
3aox	X-ray crystal structure of human anaplastic lymphoma kinase in complex with CH5424802
3b2t	Structure of phosphotransferase
3b2w	Crystal structure of pyrimidine amide 11 bound to Lck
3b8q	Crystal structure of the VEGFR2 kinase domain in complex with a naphthamide inhibitor
3b8r	Crystal structure of the VEGFR2 kinase domain in complex with a naphthamide inhibitor
3bbt	crystal structure of the ErbB4 kinase in complex with lapatinib
3bbw	crystal structure of the ErbB4 kinase in its inactive conformation
3bce	Crystal structure of the ErbB4 kinase
3be2	Crystal structure of the VEGFR2 kinase domain in complex with a benzamide inhibitor
3bea	cFMS tyrosine kinase (tie2 KID) in complex with a pyrimidinopyridone inhibitor
3bel	X-ray structure of EGFR in complex with oxime inhibitor
3bkb	Crystal structure of human Feline Sarcoma Viral Oncogene Homologue (v-FES)
3bpr	Crystal structure of catalytic domain of the proto-oncogene tyrosine-protein kinase MER in complex with inhibitor C52
3brb	Crystal structure of catalytic domain of the proto-oncogene tyrosine-protein kinase MER in complex with ADP
3bu3	Crystal structure of the insulin receptor kinase in complex with IRS2 KRLB peptide
3bu5	Crystal structure of the insulin receptor kinase in complex with IRS2 KRLB peptide and ATP
3bu6	Crystal structure of the insulin receptor kinase in complex with IRS2 KRLB phosphopeptide
3bym	X-ray co-crystal structure aminobenzimidazole triazine 1 bound to Lck
3byo	X-Ray co-crystal structure of 2-amino-6-phenylpyrimido[5',4':5,6]pyrimido[1,2-a]benzimidazol-5(6H)-one 25 bound to Lck
3bys	co-crystal structure of Lck and aminopyrimidine amide 10b
3byu	co-crystal structure of Lck and aminopyrimidine reverse amide 23
3bz3	Crystal Structure Analysis of Focal Adhesion Kinase with a Methanesulfonamide Diaminopyrimidine Inhibitor
3c1x	Crystal structure of the tyrosine kinase domain of the hepatocyte growth factor receptor c-MET in complex with a Pyrrolotriazine based inhibitor
3c4f	FGFR TYROSINE KINASE DOMAIN IN COMPLEX WITH 3-(3-methoxybenzyl)-7-azaindole
3c7q	Structure of VEGFR2 kinase domain in complex with BIBF1120
3cbl	Crystal structure of human feline sarcoma viral oncogene homologue (v-FES) in complex with staurosporine and a consensus peptide
3cc6	Crystal structure of kinase domain of protein tyrosine kinase 2 beta (PTK2B)
3ccn	X-ray structure of c-Met with triazolopyridazine inhibitor.
3cd3	Crystal structure of phosphorylated human feline sarcoma viral oncogene homologue (v-FES) in complex with staurosporine and a consensus peptide
3cd8	X-ray Structure of c-Met with triazolopyridazine Inhibitor.
3ce3	Crystal structure of the tyrosine kinase domain of the hepatocyte growth factor receptor C-MET in complex with a Pyrrolopyridinepyridone based inhibitor
3cjf	Crystal structure of VEGFR2 in complex with a 3,4,5-trimethoxy aniline containing pyrimidine
3cjg	Crystal structure of VEGFR2 in complex with a 3,4,5-trimethoxy aniline containing pyrimidine
3cly	Crystal Structure of FGF Receptor 2 (FGFR2) Kinase Domains Trapped in Trans-Phosphorylation Reaction
3cp9	Crystal structure of the VEGFR2 kinase domain in complex with a pyridone inhibitor
3cpb	Crystal structure of the VEGFR2 kinase domain in complex with a bisamide inhibitor
3cpc	Crystal structure of the VEGFR2 kinase domain in complex with a pyridone inhibitor
3cs9	Human ABL kinase in complex with nilotinib
3cth	Crystal structure of the tyrosine kinase domain of the hepatocyte growth factor receptor c-met in complex with a aminopyridine based inhibitor
3ctj	Crystal structure of the tyrosine kinase domain of the hepatocyte growth factor receptor c-met in complex with a aminopyridine based inhibitor
3d7t	Structural basis for the recognition of c-Src by its inactivator Csk
3d7u	Structural basis for the recognition of c-Src by its inactivator Csk
3d94	Crystal structure of the insulin-like growth factor-1 receptor kinase in complex with PQIP
3dk3	Crystal structure of mutant ABL kinase domain in complex with small molecule fragment
3dk6	Crystal structure of mutant ABL kinase domain in complex with small molecule fragment
3dk7	Crystal structure of mutant ABL kinase domain in complex with small molecule fragment
3dkc	SGX CLONE 5698a65KFg1h1
3dkf	SGX CLONE 5698a65KFg1h1
3dkg	SGX CLONE 5698a109KFg1h1
3dko	Complex between the kinase domain of human ephrin type-a receptor 7 (epha7) and inhibitor alw-ii-49-7
3dpk	cFMS tyrosine kinase in complex with a pyridopyrimidinone inhibitor
3dqw	c-Src kinase domain Thr338Ile mutant in complex with ATPgS
3dqx	chicken c-Src kinase domain in complex with ATPgS
3dtc	Crystal structure of mixed-lineage kinase MLK1 complexed with compound 16
3dtw	Crystal structure of the VEGFR2 kinase domain in complex with a benzisoxazole inhibitor
3dzq	Human EphA3 kinase domain in complex with inhibitor AWL-II-38.3
3e62	Fragment based discovery of JAK-2 inhibitors
3e63	Fragment based discovery of JAK-2 inhibitors
3e64	Fragment based discovery of JAK-2 inhibitors
3efj	Structure of c-Met with pyrimidone inhibitor 7
3efk	Structure of c-Met with pyrimidone inhibitor 50
3efl	Crystal structure of the VEGFR2 kinase domain in complex with motesanib
3ekk	Insulin receptor kinase complexed with an inhibitor
3ekn	Insulin receptor kinase complexed with an inhibitor
3el7	Crystal structure of c-Src in complex with pyrazolopyrimidine 3
3el8	Crystal structure of c-Src in complex with pyrazolopyrimidine 5
3emg	Discovery and SAR of novel 4-thiazolyl-2-phenylaminopyrimidines as potent inhibitors of spleen tyrosine kinase (SYK)
3en4	Targeted polypharmacology: crystal structure of the c-Src kinase domain in complex with PP121, a multitargeted kinase inhibitor
3en5	Targeted polypharmacology: crystal structure of the c-Src kinase domain in complex with PP494, a multitargeted kinase inhibitor
3en6	Targeted polypharmacology: crystal structure of the c-Src kinase domain in complex with PP102, a multitargeted kinase inhibitor
3en7	Targeted polypharmacology: crystal structure of the c-Src kinase domain in complex with S1, a multitargeted kinase inhibitor
3eqp	Crystal Structure of Ack1 with compound T95
3eqr	Crystal Structure of Ack1 with compound T74
3et7	Crystal structure of PYK2 complexed with PF-2318841
3eta	Kinase domain of insulin receptor complexed with a pyrrolo pyridine inhibitor
3ewh	Crystal structure of the VEGFR2 kinase domain in complex with a pyridyl-pyrimidine benzimidazole inhibitor
3eyg	Crystal structures of JAK1 and JAK2 inhibitor complexes
3eyh	Crystal structures of JAK1 and JAK2 inhibitor complexes
3f3t	Kinase domain of cSrc in complex with inhibitor RL38 (Type III)
3f3u	Kinase domain of cSrc in complex with inhibitor RL37 (Type III)
3f3v	Kinase domain of cSrc in complex with inhibitor RL45 (Type II)
3f3w	Drug resistant cSrc kinase domain in complex with inhibitor RL45 (Type II)
3f5p	Complex Structure of Insulin-like Growth Factor Receptor and 3-Cyanoquinoline Inhibitor
3f66	Human c-Met Kinase in complex with quinoxaline inhibitor
3f6x	c-Src kinase domain in complex with small molecule inhibitor
3f82	Crystal structure of the tyrosine kinase domain of the hepatocyte growth factor receptor C-MET in complex with N-(4-(2-amino-3-chloropyridin-4-yloxy)-3-fluorophenyl)-4-ethoxy-1-(4-fluorophenyl)-2-oxo-1,2-dihydropyridine-3-carboxamide
3fqe	Crystal structure of spleen tyrosine kinase complexed with YM193306
3fqh	Crystal structure of spleen tyrosine kinase complexed with a 2-substituted 7-azaindole
3fqs	Crystal structure of spleen tyrosine kinase complexed with R406
3fup	Crystal structures of JAK1 and JAK2 inhibitor complexes
3fxx	Human EphA3 Kinase and Juxtamembrane Region Bound to Substrate KQWDNYE[pTyr]IW
3fy2	Human EphA3 Kinase and Juxtamembrane Region Bound to Substrate KQWDNYEFIW
3fzo	Crystal Structure of PYK2-Apo, Proline-rich Tyrosine Kinase
3fzp	Crystal structure of PYK2 complexed with ATPgS
3fzr	Crystal structure of PYK2 complexed with PF-431396
3fzs	Crystal Structure of PYK2 complexed with BIRB796
3fzt	Crystal structure of PYK2 complexed with PF-4618433
3g0e	KIT kinase domain in complex with sunitinib
3g0f	KIT kinase domain mutant D816H in complex with sunitinib
3g5d	Kinase domain of cSrc in complex with Dasatinib
3g6g	Equally potent inhibition of c-Src and Abl by compounds that recognize inactive kinase conformations
3g6h	Src Thr338Ile inhibited in the DFG-Asp-Out conformation
3gen	The 1.6 A crystal structure of human bruton's tyrosine kinase bound to a pyrrolopyrimidine-containing compound
3geq	Structural basis for the chemical rescue of Src kinase activity
3gop	Crystal structure of the EGF receptor juxtamembrane and kinase domains
3gqi	Crystal Structure of activated receptor tyrosine kinase in complex with substrates
3gql	Crystal Structure of activated receptor tyrosine kinase in complex with substrates
3gt8	Crystal structure of the inactive EGFR kinase domain in complex with AMP-PNP
3gvu	The crystal structure of human ABL2 in complex with GLEEVEC
3h3c	Crystal structure of PYK2 in complex with Sulfoximine-substituted trifluoromethylpyrimidine analog
3hmi	The crystal structure of human ABL2 in complex with 5-AMINO-3-{[4-(AMINOSULFONYL)PHENYL]AMINO}-N-(2,6-DIFLUOROPHENYL)-1H-1,2,4-TRIAZOLE-1-CARBOTHIOAMIDE
3hng	Crystal structure of VEGFR1 in complex with N-(4-Chlorophenyl)-2-((pyridin-4-ylmethyl)amino)benzamide
3i5n	Crystal structure of c-Met with triazolopyridazine inhibitor 13
3i81	Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with BMS-754807 [1-(4-((5-cyclopropyl-1H-pyrazol-3-yl)amino)pyrrolo[2,1-f][1,2,4]triazin-2-yl)-N-(6-fluoro-3-pyridinyl)-2-methyl-L-prolinamide]
3ik3	AP24534, a Pan-BCR-ABL Inhibitor for Chronic Myeloid Leukemia, Potently Inhibits the T315I Mutant and Overcomes Mutation-Based Resistance
3ika	Crystal Structure of EGFR 696-1022 T790M Mutant Covalently Binding to WZ4002
3io7	2-Aminopyrazolo[1,5-a]pyrimidines as potent and selective inhibitors of JAK2
3iok	2-Aminopyrazolo[1,5-a]pyrimidines as potent and selective inhibitors of JAK2
3js2	Crystal structure of minimal kinase domain of fibroblast growth factor receptor 1 in complex with 5-(2-thienyl)nicotinic acid
3jy9	Janus Kinase 2 Inhibitors
3k54	Structures of human Bruton's tyrosine kinase in active and inactive conformations suggests a mechanism of activation for TEC family kinases.
3k5v	Structure of Abl kinase in complex with imatinib and GNF-2
3kck	A Novel Chemotype of Kinase Inhibitors
3kex	Crystal structure of the catalytically inactive kinase domain of the human epidermal growth factor receptor 3 (HER3)
3kf4	Structural analysis of DFG-in and DFG-out dual Src-Abl inhibitors sharing a common vinyl purine template
3kfa	Structural analysis of DFG-in and DFG-out dual Src-Abl inhibitors sharing a common vinyl purine template
3kmm	Structure of human LCK kinase with a small molecule inhibitor
3krj	cFMS tyrosine kinase in complex with 4-Cyano-1H-imidazole-2-carboxylic acid (2-cyclohex-1-enyl-4-piperidin-4-yl-phenyl)-amide
3krl	cFMS Tyrosine kinase in complex with 5-Cyano-furan-2-carboxylic acid [4-(4-methyl-piperazin-1-yl)-2-piperidin-1-yl-phenyl]-amide
3krr	Crystal Structure of JAK2 complexed with a potent quinoxaline ATP site inhibitor
3kul	Kinase domain of human ephrin type-A receptor 8 (EPHA8)
3kxx	Structure of the mutant Fibroblast Growth Factor receptor 1
3kxz	The complex crystal structure of LCK with a probe molecule w259
3ky2	Crystal structure of Fibroblast Growth Factor Receptor 1 kinase domain
3l8p	Crystal structure of cytoplasmic kinase domain of Tie2 complexed with inhibitor CEP11207
3l8v	Crystal structure of the tyrosine kinase domain of the hepatocyte growth factor receptor C-MET in complex with a biarylamine based inhibitor
3l9p	Crystal Structure of the Anaplastic Lymphoma Kinase Catalytic Domain
3lcd	Inhibitor Bound to A DFG-In structure of the Kinase Domain of CSF-1R
3lck	THE KINASE DOMAIN OF HUMAN LYMPHOCYTE KINASE (LCK), ACTIVATED FORM (AUTO-PHOSPHORYLATED ON TYR394)
3lco	Inhibitor Bound to A DFG-Out structure of the Kinase Domain of CSF-1R
3lcs	Crystal Structure of the Anaplastic Lymphoma Kinase Catalytic Domain
3lct	Crystal Structure of the Anaplastic Lymphoma Kinase Catalytic Domain
3lmg	Crystal structure of the ERBB3 kinase domain in complex with AMP-PNP
3lok	Drug resistant cSrc kinase domain in complex with covalent inhibitor PD168393
3lpb	Crystal structure of Jak2 complexed with a potent 2,8-diaryl-quinoxaline inhibitor
3lq8	Structure of the kinase domain of c-Met bound to XL880 (GSK1363089)
3lvp	Crystal structure of bisphosphorylated IGF1-R Kinase domain (2P) in complex with a bis-azaindole inhibitor
3lw0	IGF-1RK in complex with ligand MSC1609119A-1
3lxk	Structural and Thermodynamic Characterization of the TYK2 and JAK3 Kinase Domains in Complex with CP-690550 and CMP-6
3lxl	Structural and Thermodynamic Characterization of the TYK2 and JAK3 Kinase Domains in Complex with CP-690550 and CMP-6
3lxn	Structural and Thermodynamic Characterization of the TYK2 and JAK3 Kinase Domains in Complex with CP-690550 and CMP-6
3lxp	Structural and Thermodynamic Characterization of the TYK2 and JAK3 Kinase Domains in Complex with CP-690550 and CMP-6
3lzb	EGFR kinase domain complexed with an imidazo[2,1-b]thiazole inhibitor
3miy	X-ray crystal structure of ITK complexed with sunitinib
3mj1	X-ray crystal structure of ITK complexed with inhibitor RO5191614
3mj2	X-ray crystal structure of ITK complexed with inhibitor BMS-509744
3mpm	LCK complexed with a pyrazolopyrimidine
3ms9	ABL kinase in complex with imatinib and a fragment (FRAG1) in the myristate pocket
3mss	Abl kinase in complex with imatinib and fragment (FRAG2) in the myristate site
3nw5	Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a carbon-linked proline isostere inhibitor (11B)
3nw6	Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a carbon-linked proline isostere inhibitor (11A)
3nw7	Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a carbon-linked proline isostere inhibitor (34)
3nyx	Non-phosphorylated TYK2 JH1 domain with Quinoline-Thiadiazole-Thiophene Inhibitor
3nz0	Non-phosphorylated TYK2 kinase with CMP6
3o23	Human unphosphorylated IGF1-R Kinase domain in complex with an hydantoin inhibitor
3ocs	Crystal structure of bruton's tyrosine kinase in complex with inhibitor CGI1746
3oct	Crystal structure of bruton's tyrosine kinase mutant V555R in complex with dasatinib
3oez	crystal structure of the L317I mutant of the chicken c-Src tyrosine kinase domain complexed with imatinib
3of0	crystal structure of the L317I mutant of the chicken c-Src tyrosine kinase domain
3oxz	Crystal structure of ABL kinase domain bound with a DFG-out inhibitor AP24534
3oy3	Crystal structure of ABL T315I mutant kinase domain bound with a DFG-out inhibitor AP24589
3p08	Crystal structure of the human BTK kinase domain
3pix	Crystal structure of BTK kinase domain complexed with 2-Isopropyl-7-(4-methyl-piperazin-1-yl)-4-(5-methyl-2H-pyrazol-3-ylamino)-2H-phthalazin-1-one
3piy	Crystal structure of BTK kinase domain complexed with R406
3piz	Crystal structure of BTK kinase domain complexed with (5-Amino-1-o-tolyl-1H-pyrazol-4-yl)-[3-(1-methanesulfonyl-piperidin-4-yl)-phenyl]-methanone
3pj1	Crystal structure of BTK kinase domain complexed with 3-(2,6-Dichloro-phenyl)-7-[4-(2-diethylamino-ethoxy)-phenylamino]-1-methyl-3,4-dihydro-1H-pyrimido[4,5-d]pyrimidin-2-one
3pj2	Crystal structure of BTK kinase domain complexed with 2-[4-(2-Diethylamino-ethoxy)-phenylamino]-6-(4-fluoro-phenoxy)-8-methyl-8H-pyrido[2,3-d]pyrimidin-7-one
3pj3	Crystal structure of BTK kinase domain complexed with 2-Methyl-5-[(E)-(3-phenyl-acryloyl)amino]-N-(2-phenyl-3H-imidazo[4,5-b]pyridin-6-yl)-benzamide
3pjc	Crystal structure of JAK3 complexed with a potent ATP site inhibitor showing high selectivity within the Janus kinase family
3pls	RON in complex with ligand AMP-PNP
3poz	EGFR Kinase domain complexed with tak-285
3pp0	Crystal Structure of the Kinase domain of Human HER2 (erbB2).
3pxk	FOCAL ADHESION KINASE CATALYTIC DOMAIN IN COMPLEX WITH Pyrrolo[2,3-d]thiazole
3pyy	Discovery and Characterization of a Cell-Permeable, Small-molecule c-Abl Kinase Activator that Binds to the Myristoyl Binding Site
3q32	Structure of Janus kinase 2 with a pyrrolotriazine inhibitor
3q6u	Structure of the apo MET receptor kinase in the dually-phosphorylated, activated state
3q6w	Structure of dually-phosphorylated MET receptor kinase in complex with an MK-2461 analog with specificity for the activated receptor
3qgw	Crystal Structure of ITK kinase bound to an inhibitor
3qgy	Crystal structure of ITK inhibitor complex
3qlf	Crystal structure of the L317I mutant of the C-src tyrosine kinase domain complexed with pyrazolopyrimidine 5
3qlg	Crystal structure of the L317I mutant of the C-src tyrosine kinase domain complexed with dasatinib
3qqu	Cocrystal structure of unphosphorylated igf with pyrimidine 8
3qri	The crystal structure of human abl1 kinase domain in complex with DCC-2036
3qrj	The crystal structure of human abl1 kinase domain T315I mutant in complex with DCC-2036
3qrk	The crystal structure of human abl1 kinase domain in complex with DP-987
3qti	c-Met Kinase in Complex with NVP-BVU972
3qup	Inhibitor bound structure of the kinase domain of the murine receptor tyrosine kinase TYRO3 (Sky)
3r7o	Structure of dually phosphorylated c-MET receptor kinase in complex with an MK-2461 analog
3rcd	HER2 Kinase Domain Complexed with TAK-285
3rhk	Crystal structure of the catalytic domain of c-Met kinase in complex with ARQ 197
3rhx	Crystal structure of the catalytic domain of FGFR1 kinase in complex with ARQ 069
3ri1	Crystal structure of the catalytic domain of FGFR2 kinase in complex with ARQ 069
3rvg	Crystals structure of Jak2 with a 1-amino-5H-pyrido[4,3-b]indol-4-carboxamide inhibitor
3srv	Crystal structure of spleen tyrosine kinase (SYK) in complex with a diaminopyrimidine carboxamide inhibitor
3svv	Crystal Structure of T338C c-Src covalently bound to vinylsulfonamide-pyrazolopyrimidine 9
3sxr	Crystal structure of BMX non-receptor tyrosine kinase complex with dasatinib
3sxs	Crystal structure of BMX non-receptor tyrosine kinase complexed with PP2
3t9t	Crystal structure of BTK mutant (F435T,K596R) complexed with Imidazo[1,5-a]quinoxaline
3tcp	Crystal structure of the catalytic domain of the proto-oncogene tyrosine-protein kinase MER in complex with inhibitor UNC569
3tjc	Co-crystal structure of jak2 with thienopyridine 8
3tjd	co-crystal structure of Jak2 with thienopyridine 19
3tt0	Co-structure of Fibroblast Growth Factor Receptor 1 kinase domain with 3-(2,6-dichloro-3,5-dimethoxy-phenyl)-1-{6-[4-(4-ethyl-piperazin-1-yl)-phenylamino]-pyrimidin-4-yl}-1-methyl-urea (BGJ398)
3tub	Crystal structure of SYK kinase domain with 1-(5-(6,7-dimethoxyquinolin-4-yloxy)pyridin-2-yl)-3-((1R,2S)-2-phenylcyclopropyl)urea
3tuc	Crystal structure of SYK kinase domain with 1-benzyl-N-(5-(6,7-dimethoxyquinolin-4-yloxy)pyridin-2-yl)-2-oxo-1,2-dihydropyridine-3-carboxamide
3tud	Crystal structure of SYK kinase domain with N-(4-methyl-3-(8-methyl-7-oxo-2-(phenylamino)-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)-3-(trifluoromethyl)benzamide
3tz7	Kinase domain of cSrc in complex with RL103
3tz8	Kinase domain of cSrc in complex with RL104
3tz9	Kinase domain of cSrc in complex with RL130
3u4w	Src in complex with DNA-templated macrocyclic inhibitor MC4b
3u51	Src in complex with DNA-templated macrocyclic inhibitor MC1
3u6h	Crystal structure of c-Met in complex with pyrazolone inhibitor 26
3u6i	Crystal structure of c-Met in complex with pyrazolone inhibitor 58a
3u6j	Crystal structure of the VEGFR2 kinase domain in complex with a pyrazolone inhibitor
3ue4	Structural and spectroscopic analysis of the kinase inhibitor bosutinib binding to the Abl tyrosine kinase domain
3ug1	Crystal structure of the mutated EGFR kinase domain (G719S/T790M) in the apo form
3ug2	Crystal structure of the mutated EGFR kinase domain (G719S/T790M) in complex with gefitinib
3ugc	Structural basis of Jak2 inhibition by the type II inhibtor NVP-BBT594
3uqf	c-SRC kinase domain in complex with BKI RM-1-89
3uqg	c-SRC kinase domain in complex with bumpless BKI analog UW1243
3v5j	Crystal Structure of Interleukin-2 Inducible T-cell Kinase Itk Catalytic Domain with Thienopyrazolylindole Inhibitor 090
3v5l	Crystal Structure of Interleukin-2 Inducible T-cell Kinase Itk Catalytic Domain with Thienopyrazolylindole Inhibitor 542
3v5q	Discovery of a selective TRK Inhibitor with efficacy in rodent cancer tumor models
3v8t	Crystal Structure of Interleukin-2 Inducible T-cell Kinase Itk Catalytic Domain with Thienopyrazolylindole Inhibitor 477
3v8w	Crystal Structure of Interleukin-2 Inducible T-cell Kinase Itk Catalytic Domain with Thienopyrazolylindole Inhibitor 469
3vf8	Crystal Structure of Spleen Tyrosine Kinase Syk Catalytic Domain with Pyrazolylbenzimidazole Inhibitor 416
3vf9	Crystal Structure of Spleen Tyrosine Kinase Syk Catalytic Domain with Thienopyrazolylindole Inhibitor 027
3vhe	Crystal structure of human VEGFR2 kinase domain with a novel pyrrolopyrimidine inhibitor.
3vhk	Crystal structure of the VEGFR2 kinase domain in complex with a back pocket binder
3vid	Crystal structure of human VEGFR2 kinase domain with Compound A.
3vjn	Crystal structure of the mutated EGFR kinase domain (G719S/T790M) in complex with AMPPNP.
3vjo	Crystal structure of the wild-type EGFR kinase domain in complex with AMPPNP.
3vnt	Crystal Structure of the Kinase domain of Human VEGFR2 with a [1,3]thiazolo[5,4-b]pyridine derivative
3vo3	Crystal Structure of the Kinase domain of Human VEGFR2 with imidazo[1,2-b]pyridazine derivative
3vry	Crystal structure of HCK complexed with a pyrrolo-pyrimidine inhibitor 4-Amino-5-(4-phenoxyphenyl)-7H-pyrrolo[2,3-d]pyrimidin-7-yl-cyclopentane
3vrz	Crystal structure of HCK complexed with a pyrrolo-pyrimidine inhibitor 1-[4-(4-amino-7-cyclopentyl-7H-pyrrolo[2,3-d]pyrimidin-5-yl)phenyl]-3-benzylurea
3vs0	Crystal structure of HCK complexed with a pyrrolo-pyrimidine inhibitor N-[4-(4-amino-7-cyclopentyl-7H-pyrrolo[2,3-d]pyrimidin-5-yl)phenyl]benzamide
3vs1	Crystal structure of HCK complexed with a pyrrolo-pyrimidine inhibitor 1-[4-(4-amino-7-cyclopentyl-7H-pyrrolo[2,3-d]pyrimidin-5-yl)phenyl]-3-phenylurea
3vs2	Crystal structure of HCK complexed with a pyrrolo-pyrimidine inhibitor 7-[cis-4-(4-methylpiperazin-1-yl)cyclohexyl]-5-(4-phenoxyphenyl)-7H-pyrrolo[2,3-d]pyrimidin-4-amine
3vs3	Crystal structure of HCK complexed with a pyrrolo-pyrimidine inhibitor 7-[trans-4-(4-methylpiperazin-1-yl)cyclohexyl]-5-(4-phenoxyphenyl)-7H-pyrrolo[2,3-d]pyrimidin-4-amine
3vs4	Crystal structure of HCK complexed with a pyrrolo-pyrimidine inhibitor 5-(4-phenoxyphenyl)-7-(tetrahydro-2H-pyran-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-4-amine
3vs5	Crystal structure of HCK complexed with a pyrrolo-pyrimidine inhibitor 7-(1-methylpiperidin-4-yl)-5-(4-phenoxyphenyl)-7H-pyrrolo[2,3-d]pyrimidin-4-amine
3vs6	Crystal structure of HCK complexed with a pyrazolo-pyrimidine inhibitor tert-butyl {4-[4-amino-1-(propan-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl]-2-methoxyphenyl}carbamate
3vs7	Crystal structure of HCK complexed with a pyrazolo-pyrimidine inhibitor 1-cyclopentyl-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine
3vw8	Crystal structure of human c-Met kinase domain with its inhibitor
3w2o	EGFR Kinase domain T790M/L858R Mutant with TAK-285
3w2p	EGFR Kinase domain T790M/L858R mutant with compound 2
3w2q	EGFR kinase domain T790M/L858R mutant with HKI-272
3w2r	EGFR Kinase domain T790M/L858R mutant with compound 4
3w2s	EGFR kinase domain with compound4
3w32	EGFR kinase domain complexed with compound 20a
3w33	EGFR kinase domain complexed with compound 19b
3wzd	3WZD
3wze	3WZE
3zbf	Structure of Human ROS1 Kinase Domain in Complex with Crizotinib
3zbx	X-ray Structure of c-Met kinase in complex with inhibitor 6-((6-(4- fluorophenyl)-(1,2,4)triazolo(4,3-b)(1,2,4)triazin-3-yl)methyl) quinoline.
3zc5	X-ray Structure of c-Met kinase in complex with inhibitor (S)-6-(1-(6- (1-methyl-1H-pyrazol-4-yl)-(1,2,4)triazolo(4,3-b)pyridazin-3-yl)ethyl) quinoline.
3zc6	Crystal structure of JAK3 kinase domain in complex with an indazole substituted pyrrolopyrazine
3zcl	X-ray Structure of c-Met kinase in complex with inhibitor (S)-3-(1-( 1H-pyrrolo(2,3-b)pyridin-3-yl)ethyl)-N-isopropyl-(1,2,4)triazolo(4,3- b)pyridazin-6-amine
3zep	Crystal Structure of JAK3 Kinase Domain in Complex with a Pyrrolopyrazine-2-phenyl Ether Inhibitor
3zew	Crystal structure of EphB4 in complex with staurosporine
3zfm	Crystal structure of EphB2
3zfx	Crystal structure of EphB1
3zfy	Crystal structure of EphB3
3zmm	Inhibitors of Jak2 Kinase domain
3zos	Crystal structure of the human DDR1 kinase domain
3zxz	X-ray Structure of PF-04217903 bound to the kinase domain of c-Met
3zze	Crystal structure of C-MET kinase domain in complex with N'-((3Z)-4- chloro-7-methyl-2-oxo-1,2-dihydro-3H-indol-3-ylidene)-2-(4- hydroxyphenyl)propanohydrazide
3zzw	Crystal structure of the kinase domain of ROR2
4ag8	CRYSTAL STRUCTURE OF THE VEGFR2 KINASE DOMAIN IN COMPLEX WITH AXITINIB (AG-013736) (N-Methyl-2-(3-((E)-2-pyridin-2-yl-vinyl)-1H- indazol-6-ylsulfanyl)-benzamide)
4agc	CRYSTAL STRUCTURE OF VEGFR2 (JUXTAMEMBRANE AND KINASE DOMAINS) IN COMPLEX WITH AXITINIB (AG-013736) (N-Methyl-2-(3-((E)-2-pyridin-2-yl- vinyl)-1H-indazol-6-ylsulfanyl)-benzamide)
4agd	CRYSTAL STRUCTURE OF VEGFR2 (JUXTAMEMBRANE AND KINASE DOMAINS) IN COMPLEX WITH SUNITINIB (SU11248) (N-2-diethylaminoethyl)-5-((Z)-(5- fluoro-2-oxo-1H-indol-3-ylidene)methyl)-2,4-dimethyl-1H-pyrrole-3- carboxamide)
4agw	Discovery of a small molecule type II inhibitor of wild-type and gatekeeper mutants of BCR-ABL, PDGFRalpha, Kit, and Src kinases
4anl	Structure of G1269A Mutant Anaplastic Lymphoma Kinase
4anq	Structure of G1269A Mutant Anaplastic Lymphoma Kinase in Complex with Crizotinib
4ans	Structure of L1196M,G1269A Double Mutant Anaplastic Lymphoma Kinase in Complex with Crizotinib
4aoi	Crystal structure of C-MET kinase domain in complex with 4-(3-((1H- pyrrolo(2,3-b)pyridin-3-yl)methyl)-(1,2,4)triazolo(4,3-b)(1,2,4) triazin-6-yl)benzonitrile
4aoj	Human TrkA in complex with the inhibitor AZ-23
4ap7	Crystal structure of C-MET kinase domain in complex with 4-((6-(4- fluorophenyl)-(1,2,4)triazolo(4,3-b)(1,2,4)triazin-3-yl)methyl)phenol
4aqc	Triazolopyridine-based Inhibitor of Janus Kinase 2
4asd	CRYSTAL STRUCTURE OF VEGFR2 (JUXTAMEMBRANE AND KINASE DOMAINS) IN COMPLEX WITH SORAFENIB (BAY 43-9006)
4ase	CRYSTAL STRUCTURE OF VEGFR2 (JUXTAMEMBRANE AND KINASE DOMAINS) IN COMPLEX WITH TIVOZANIB (AV-951)
4asz	Crystal structure of apo TrkB kinase domain
4at3	CRYSTAL STRUCTURE OF TRKB KINASE DOMAIN IN COMPLEX WITH CPD5N
4at4	CRYSTAL STRUCTURE OF TRKB KINASE DOMAIN IN COMPLEX WITH EX429
4at5	CRYSTAL STRUCTURE OF TRKB KINASE DOMAIN IN COMPLEX WITH GW2580
4aw5	Complex of the EphB4 kinase domain with an oxindole inhibitor
4bb4	ephB4 kinase domain inhibitor complex
4bbe	Aminoalkylpyrimidine Inhibitor Complexes with JAK2
4bbf	Aminoalkylpyrimidine Inhibitor Complexes with JAK2
4bkj	Crystal structure of the human DDR1 kinase domain in complex with imatinib
4brx	Focal Adhesion Kinase catalytic domain in complex with a diarylamino- 1,3,5-triazine inhibitor
4c3f	Structure of Lck in complex with a compound discovered by Virtual Fragment Linking
4c61	Inhibitors of Jak2 Kinase domain
4c62	Inhibitors of Jak2 Kinase domain
4c7t	Focal Adhesion Kinase catalytic domain in complex with a diarylamino- 1,3,5-triazine inhibitor
4ccb	Structure of the Human Anaplastic Lymphoma Kinase in Complex with 3-(( R)-1-(5-fluoro-2-(2H-1,2,3-triazol-2-yl)phenyl)ethoxy)-5-(5-methyl-1H- pyrazol-4-yl)pyridin-2-amine
4ccu	Structure of the Human Anaplastic Lymphoma Kinase in Complex with 2-( 5-(6-amino-5-((R)-1-(5-fluoro-2-(2H-1,2,3-triazol-2-yl)phenyl)ethoxy) pyridin-3-yl)-4-methylthiazol-2-yl)propan-2-ol
4cd0	Structure of L1196M Mutant Human Anaplastic Lymphoma Kinase in Complex with 2-(5-(6-amino-5-((R)-1-(5-fluoro-2-(2H-1,2,3-triazol-2- yl)phenyl)ethoxy)pyridin-3-yl)-4-methylthiazol-2-yl)propane-1,2-diol
4cki	Crystal Structure of oncogenic RET tyrosine kinase M918T bound to adenosine
4ckj	Crystal structure of RET tyrosine kinase domain bound to adenosine
4ckr	Crystal structure of the human DDR1 kinase domain in complex with DDR1-IN-1
4cli	4CLI
4clj	4CLJ
4cmo	4CMO
4cmt	4CMT
4cmu	4CMU
4cnh	4CNH
4csv	4CSV
4ctb	4CTB
4ctc	4CTC
4d0w	4D0W
4d0x	4D0X
4d1s	4D1S
4d2r	4D2R
4d4r	4D4R
4d4s	4D4S
4d4v	4D4V
4d4y	4D4Y
4d55	4D55
4d58	4D58
4d5h	4D5H
4d5k	4D5K
4dce	Crystal structure of human anaplastic lymphoma kinase in complex with a piperidine-carboxamide inhibitor
4deg	Crystal structure of c-Met in complex with triazolopyridazine inhibitor 2
4deh	Crystal structure of c-Met in complex with triazolopyridinone inhibitor 3
4dei	Crystal structure of c-Met in complex with triazolopyridinone inhibitor 24
4dfl	Crystal structure of spleen tyrosine kinase complexed with a sulfonamidopyrazine piperidine inhibitor
4dfn	Crystal structure of spleen tyrosine kinase complexed with an adamantylpyrazine inhibitor
4dgg	c-SRC kinase domain in complex with RM-1-176
4e1z	Structure of mouse Tyk-2 complexed to a 3-aminoindazole inhibitor
4e20	Structure of mouse Tyk-2 complexed to a 3-aminoindazole inhibitor
4e4l	JAK1 kinase (JH1 domain) in complex with compound 30
4e4m	JAK2 kinase (JH1 domain) in complex with compound 30
4e4n	JAK1 kinase (JH1 domain) in complex with compound 49
4e5w	JAK1 kinase (JH1 domain) in complex with compound 26
4e6d	JAK2 kinase (JH1 domain) triple mutant in complex with compound 7
4e6q	JAK2 kinase (JH1 domain) triple mutant in complex with compound 12
4e93	Crystal structure of human Feline Sarcoma Viral Oncogene Homologue (v-FES)in complex with TAE684
4ebv	Structure of Focal Adhesion Kinase catalytic domain in complex with novel allosteric inhibitor
4ebw	Structure of Focal Adhesion Kinase catalytic domain in complex with novel allosteric inhibitor
4eev	Crystal structure of c-Met in complex with LY2801653
4ehz	The Jak1 kinase domain in complex with inhibitor
4ei4	JAK1 kinase (JH1 domain) in complex with compound 20
4ewh	Co-crystal structure of ACK1 with inhibitor
4f08	Discovery and Optimization of C-2 Methyl Imidazo-pyrrolopyridines as Potent and Orally Bioavailable JAK1 Inhibitors with Selectivity over JAK2
4f09	Discovery and Optimization of C-2 Methyl Imidazo-pyrrolopyridines as Potent and Orally Bioavailable JAK1 Inhibitors with Selectivity over JAK2
4f0i	Crystal structure of apo TrkA
4f4p	SYK in COMPLEX WITH LIGAND LASW836
4f63	Crystal structure of Human Fibroblast Growth Factor Receptor 1 Kinase domain in complex with compound 1
4f64	Crystal structure of Human Fibroblast Growth Factor Receptor 1 Kinase domain in complex with compound 6
4f65	Crystal structure of Human Fibroblast Growth Factor Receptor 1 Kinase domain in complex with compound 8
4feq	Inhibitor bound structure of the kinase domain of the murine receptor tyrosine kinase TYRO3 (Sky)
4ff8	Inhibitor bound structure of the kinase domain of the murine receptor tyrosine kinase TYRO3 (Sky)
4fic	Kinase domain of cSrc in complex with a hinge region-binding fragment
4fk6	JAK1 kinase (JH1 domain) in complex with compound 72
4fl1	Structural and Biophysical Characterization of the Syk Activation Switch
4fl2	Structural and Biophysical Characterization of the Syk Activation Switch
4fl3	Structural and Biophysical Characterization of the Syk Activation Switch
4fnw	Crystal structure of the apo F1174L anaplastic lymphoma kinase catalytic domain
4fnx	Crystal structure of the apo R1275Q anaplastic lymphoma kinase catalytic domain
4fny	Crystal structure of the R1275Q anaplastic lymphoma kinase catalytic domain in complex with a benzoxazole inhibitor
4fnz	Crystal structure of human anaplastic lymphoma kinase in complex with piperidine-carboxamide inhibitor 2
4fob	Crystal structure of human anaplastic lymphoma kinase in complex with acyliminobenzimidazole inhibitor 1
4foc	Crystal structure of human anaplastic lymphoma kinase in complex with acyliminobenzimidazole inhibitor 2
4fod	Crystal structure of human anaplastic lymphoma kinase in complex with acyliminobenzimidazole inhibitor 36
4fyn	Crystal structure of spleen tyrosine kinase complexed with 3-(8-{4-[Ethyl-(2-hydroxy-ethyl)-amino]-phenylamino}-imidazo[1,2-a]pyrazin-5-yl)-phenol
4fyo	Crystal structure of spleen tyrosine kinase complexed with N-{(S)-1-[7-(3,4-Dimethoxy-phenylamino)-thiazolo[5,4-d]pyrimidin-5-yl]-pyrrolidin-3-yl}-terephthalamic acid
4fz6	Crystal structure of spleen tyrosine kinase complexed with [6-((S)-2-Methyl-pyrrolidin-1-yl)-pyridin-2-yl]-(6-phenyl-imidazo[1,2-b]pyridazin-8-yl)-amine
4fz7	Crystal structure of spleen tyrosine kinase complexed with 6-((1R,2S)-2-Amino-cyclohexylamino)-4-(6-ethyl-pyridin-2-ylamino)-pyridazine-3-carboxylic acid amide
4g2f	Human EphA3 kinase domain in complex with compound 7
4g5j	Crystal structure of EGFR kinase in complex with BIBW2992
4g5p	Crystal structure of EGFR kinase T790M in complex with BIBW2992
4gfg	Crystal structure of spleen tyrosine kinase complexed with r9021
4gfm	JAK2 kinase (JH1 domain) with 2,6-DICHLORO-N-(2-OXO-2,5-DIHYDROPYRIDIN-4-YL)BENZAMIDE
4gfo	TYK2 kinase (JH1 domain) with 2,6-DICHLORO-N-(2-OXO-2,5-DIHYDROPYRIDIN-4-YL)BENZAMIDE
4gg5	Crystal structure of CMET in complex with novel inhibitor
4gg7	Crystal structure of cMET in complex with novel inhibitor
4gih	Tyk2 (JH1) in complex with 2,6-DICHLORO-N-{2-[(CYCLOPROPYLCARBONYL)AMINO]PYRIDIN-4-YL}BENZAMIDE
4gii	Tyk2 (JH1) in complex with 2,6-dichloro-4-cyano-N-{2-[(cyclopropylcarbonyl)amino]pyridin-4-yl}benzamide
4gj2	Tyk2 (JH1) in complex with 2,6-dichloro-N-[2-({[(1R,2R)-2-fluorocyclopropyl]carbonyl}amino)pyridin-4-yl]benzamide
4gj3	Tyk2 (JH1) in complex with 2,6-dichloro-4-cyano-N-[2-({[(1R,2R)-2-fluorocyclopropyl]carbonyl}amino)pyridin-4-yl]benzamide
4gk2	Human EphA3 Kinase domain in complex with ligand 66
4gk3	Human EphA3 Kinase domain in complex with ligand 87
4gk4	Human EphA3 Kinase domain in complex with ligand 90
4gl9	Crystal structure of inhibitory protein SOCS3 in complex with JAK2 kinase domain and fragment of GP130 intracellular domain
4gmy	JAK2 kinase (JH1 domain) in complex with 2,6-DICHLORO-N-{2-[(CYCLOPROPYLCARBONYL)AMINO]PYRIDIN-4-YL}BENZAMIDE
4gt4	Structure of unliganded, inactive Ror2 kinase domain
4gt5	Crystal structure of the inactive TrkA kinase domain
4gu6	FOCAL ADHESION KINASE CATALYTIC DOMAIN IN COMPLEX WITH N-{3-[(5-Cyano-2-phenyl-1H-pyrrolo[2,3-b]pyridin-4-ylamino)- methyl]-pyridin-2-yl}-N-methyl-methanesulfonamide
4gu9	Focal adhesion kinase catalytic domain in complex with (2-Fluoro-phenyl)-(1H-pyrazolo[3,4-d]pyrimidin-4-yl)-amine
4gvj	Tyk2 (JH1) in complex with adenosine di-phosphate
4h1j	Crystal structure of PYK2 with the pyrazole 13a
4h1m	Crystal structure of PYK2 with the indole 10c
4hct	Crystal structure of ITK in complex with compound 52
4hcu	Crystal structure of ITK in complext with compound 40
4hcv	Crystal structure of ITK in complex with compound 53
4hge	JAK2 kinase (JH1 domain) in complex with compound 8
4hjo	Crystal structure of the inactive EGFR tyrosine kinase domain with erlotinib
4hvd	JAK3 kinase domain in complex with 2-Cyclopropyl-5H-pyrrolo[2,3-b]pyrazine-7-carboxylic acid ((S)-1,2,2-trimethyl-propyl)-amide
4hvg	JAK3 kinase domain in complex with 2-Cyclopropyl-5H-pyrrolo[2,3-b]pyrazine-7-carboxylic acid ((S)-2-hydroxy-1,2-dimethyl-propyl)-amide
4hvh	JAK3 kinase domain in complex with 2-Cyclopropyl-5H-pyrrolo[2,3-b]pyrazine-7-carboxylic acid ((R)-2-hydroxy-1,2-dimethyl-propyl
4hvi	JAK3 kinase domain in complex with 2-Cyclopropyl-5H-pyrrolo[2,3-b]pyrazine-7-carboxylic acid ((R)-1-methyl-2-oxo-2-piperidin-1-yl-ethyl)-amide
4hvs	Crystal structure of KIT kinase domain with a small molecule inhibitor, PLX647
4hw7	Crystal structure of FMS kinase domain with a small molecular inhibitor, PLX647-OME
4hzr	Crystal structure of Ack1 kinase domain
4hzs	Crystal structure of Ack1 kinase domain with C-terminal SH3 domain
4i0r	Crystal structure of spleen tyrosine kinase complexed with 2-(3,4,5-Trimethoxy-phenyl)-5H-pyrrolo[2,3-b]pyrazine-7-carboxylic acid isopropylamide
4i0s	Crystal structure of spleen tyrosine kinase complexed with 2-(6-Chloro-1-methyl-1H-indazol-3-yl)-5H-pyrrolo[2,3-b]pyrazine-7-carboxylic acid isopropylamide
4i0t	Crystal structure of spleen tyrosine kinase complexed with 2-(5,6,7,8-Tetrahydro-imidazo[1,5-a]pyridin-1-yl)-5H-pyrrolo[2,3-b]pyrazine-7-carboxylic acid tert-butylamide
4i1z	Crystal structure of the monomeric (V948R) form of the gefitinib/erlotinib resistant EGFR kinase domain L858R+T790M
4i20	Crystal structure of monomeric (V948R) primary oncogenic mutant L858R EGFR kinase domain
4i21	Crystal structure of L858R + T790M EGFR kinase domain in complex with MIG6 peptide
4i22	Structure of the monomeric (V948R)gefitinib/erlotinib resistant double mutant (L858R+T790M) EGFR kinase domain co-crystallized with gefitinib
4i23	Crystal structure of the wild-type EGFR kinase domain in complex with dacomitinib (soaked)
4i24	Structure of T790M EGFR kinase domain co-crystallized with dacomitinib
4i4e	Structure of Focal Adhesion Kinase catalytic domain in complex with hinge binding pyrazolobenzothiazine compound.
4i4f	Structure of Focal Adhesion Kinase catalytic domain in complex with an allosteric binding pyrazolobenzothiazine compound.
4i5c	The Jak1 kinase domain in complex with inhibitor
4i6q	JAK3 kinase domain in complex with 2-Phenoxy-5H-pyrrolo[2,3-b]pyrazine-7-carboxylic acid ((S)-1-cyclopropyl-ethyl)-amide
4ibm	Crystal structure of insulin receptor kinase domain in complex with an inhibitor Irfin-1
4id7	ACK1 kinase in complex with the inhibitor cis-3-[8-amino-1-(4-phenoxyphenyl)imidazo[1,5-a]pyrazin-3-yl]cyclobutanol
4iva	JAK2 kinase (JH1 domain) in complex with the inhibitor TRANS-4-[(8AS)-2-[(1R)-1-HYDROXYETHYL]IMIDAZO[4,5-D]PYRROLO[2,3-B]PYRIDIN-1(8AH)-YL]CYCLOHEXANECARBONITRILE
4ivb	JAK1 kinase (JH1 domain) in complex with the inhibitor TRANS-4-{2-[(1R)-1-HYDROXYETHYL]IMIDAZO[4,5-D]PYRROLO[2,3-B]PYRIDIN-1(6H)-YL}CYCLOHEXANECARBONITRILE
4ivc	JAK1 kinase (JH1 domain) in complex with the inhibitor (TRANS-4-{2-[(1R)-1-HYDROXYETHYL]IMIDAZO[4,5-D]PYRROLO[2,3-B]PYRIDIN-1(6H)-YL}CYCLOHEXYL)ACETONITRILE
4ivd	JAK1 kinase (JH1 domain) in complex with compound 34
4iwd	Structure of dually phosphorylated c-MET receptor kinase in complex with an MK-8033 analog
4j95	Crystal Strucure of FGF Receptor 2 (FGFR2) Kinase Domain Harboring the Pathogenic K659N Mutation Responsible for an Unclassified Craniosynostosis Syndrome in Space Group C2.
4j96	Crystal Strucure of FGF Receptor 2 (FGFR2) Kinase Domain Harboring the Pathogenic Gain-of-Function K659M Mutation Identified in Cervical Cancer.
4j97	Crystal Strucure of FGF Receptor 2 (FGFR2) Kinase Domain Harboring the Pathogenic Gain-of-Function K659E Mutation Identified in Endometrial Cancer.
4j98	Crystal Strucure of FGF Receptor 2 (FGFR2) Kinase Domain Harboring the Gain-of-Function K659Q Mutation.
4j99	Crystal Strucure of FGF Receptor 2 (FGFR2) Kinase Domain Harboring the Gain-of-Function K659T Mutation.
4ji9	JAK2 kinase (JH1 domain) in complex with TG101209
4jia	JAK2 kinase (JH1 domain) in complex with compound 9
4joa	Crystal Structure of Human Anaplastic Lymphoma Kinase in complex with 7-azaindole based inhibitor
4jq7	Crystal structure of EGFR kinase domain in complex with compound 2a
4jq8	Crystal structure of EGFR kinase domain in complex with compound 4b
4jr3	Crystal structure of EGFR kinase domain in complex with compound 3g
4jrv	Crystal structure of EGFR kinase domain in complex with compound 4c
4k11	The structure of 1NA in complex with Src T338G
4k2r	Structural basis for activation of ZAP-70 by phosphorylation of the SH2-kinase linker
4k33	Crystal Strucure of FGF Receptor 3 (FGFR3) Kinase Domain Harboring the K650E Mutation, a Gain-of-Function Mutation Responsible for Thanatophoric Dysplasia Type II and Spermatocytic Seminoma
4k6z	The Jak1 kinase domain in complex with compound 37
4k77	JAK1 kinase (JH1 domain) in complex with compound 6
4k8a	Fragment-based discovery of Focal Adhesion Kinase Inhibitors
4k9y	FOCAL ADHESION KINASE Catalytic domain in complex with 1-[4-(6-Amino-purin-9-yl)-phenyl]-3-(5-tert-butyl-2-p-tolyl-2H-pyrazol-3-yl)-urea
4kab	FOCAL ADHESION KINASE CATALYTIC DOMAIN IN COMPLEX WITH 3-Methyl-1,4-dihydro-pyrazolo[4,5-c]pyrazole
4kao	FOCAL ADHESION KINASE CATALYTIC DOMAIN IN COMPLEX WITH 1-(5-tert-Butyl-2-p-tolyl-2H-pyrazol-3-yl)-3-(4-pyridin-3- yl-phenyl)-urea
4kio	Kinase domain mutant of human Itk in complex with a covalently-binding inhibitor
4knb	C-Met in complex with OSI ligand
4l7s	Kinase domain mutant of human Itk in complex with an aminobenzothiazole inhibitor
4lgg	Structure of 3MB-PP1 bound to analog-sensitive Src kinase
4lgh	Crystal structure of 1NM-PP1 bound to analog-sensitive Src kinase
4li5	EGFR-K IN COMPLEX WITH N-[3-[[5-chloro-4-(1H-indol-3-yl)pyrimidin-2-yl]amino]-4-methoxy-phenyl] Prop-2-enamide
4ll0	EGFR L858R/T790M in complex with PD168393
4lqm	EGFR L858R in complex with PD168393
4lrm	EGFR D770_N771insNPG in complex with PD168393
4lud	Crystal Structure of HCK in complex with the fluorescent compound SKF86002
4lue	Crystal Structure of HCK in complex with 7-[trans-4-(4-methylpiperazin-1-yl)cyclohexyl]-5-(4-phenoxyphenyl)-7H-pyrrolo[2,3-d]pyrimidin-4-amine (resulting from displacement of SKF86002)
4m0y	Crystal structure of ITK in complex with compound 1 [4-(carbamoylamino)-1-(naphthalen-1-yl)-1H-pyrazole-3-carboxamide]
4m0z	Crystal structure of ITK in complex with compound 5 {4-(carbamoylamino)-1-(7-methoxynaphthalen-1-yl)-1H-pyrazole-3-carboxamide}
4m12	Crystal structure of ITK in complex with compound 7 [4-(carbamoylamino)-1-(7-ethoxynaphthalen-1-yl)-1H-pyrazole-3-carboxamide]
4m13	Crystal structure of ITK in complex with compound 8 [4-(carbamoylamino)-1-(7-propoxynaphthalen-1-yl)-1H-pyrazole-3-carboxamide]
4m14	Crystal structure of ITK in complex with compound 9 [4-(carbamoylamino)-1-[7-(propan-2-yloxy)naphthalen-1-yl]-1H-pyrazole-3-carboxamide]
4m15	Crystal structure of ITK in complex with compound 9 [4-(carbamoylamino)-1-[7-(propan-2-yloxy)naphthalen-1-yl]-1H-pyrazole-3-carboxamide] and ADP
4m3q	Crystal structure of the catalytic domain of the proto-oncogene tyrosine-protein kinase MER in complex with inhibitor UNC1917
4mcv	Star 12 bound to analog-sensitive Src kinase
4mf0	ITK kinase domain in complex with benzothiazole inhibitor compound 12a (1S,2S)-2-{4-[(DIMETHYLAMINO)METHYL]PHENYL}-N-[6-(PYRIDIN-3-YL)-1,3-BENZOTHIAZOL-2-YL]CYCLOPROPANECARBOXAMIDE (12a)
4mf1	ITK kinase domain in complex with benzothiazole inhibitor 12b (1S,2S)-2-{4-[(DIMETHYLAMINO)METHYL]PHENYL}-N-[6-(1H-PYRAZOL-4-YL)-1,3-BENZOTHIAZOL-2-YL]CYCLOPROPANECARBOXAMIDE
4mh7	Crystal structure of the catalytic domain of the proto-oncogene tyrosine-protein kinase MER in complex with inhibitor UNC1896
4mha	Crystal structure of the catalytic domain of the proto-oncogene tyrosine-protein kinase MER in complex with inhibitor UNC1817
4mkc	Crystal Structure of Anaplastic Lymphoma Kinase Complexed with LDK378
4mxc	4MXC
4mxo	human Src kinase bound to kinase inhibitor bosutinib
4mxx	Human Src A403T mutant bound to kinase inhibitor bosutinib
4mxy	Src M314L T338M double mutant bound to kinase inhibitor bosutinib
4mxz	Src M314L T338M double mutant bound to kinase inhibitor bosutinib
4nk9	Crystal structure of human fibroblast growth factor receptor 1 kinase domain in complex with pyrazolaminopyrimidine 1
4nka	Crystal structure of human fibroblast growth factor receptor 1 kinase domain in complex with pyrazolaminopyrimidine 2
4nks	Crystal structure of human fibroblast growth factor receptor 1 kinase domain in complex with pyrazolaminopyrimidine 3
4nwm	Crystal structure of Bruton agammaglobulinemia tyrosine kinase complexed with BMS-809959 aka 4-tert-butyl-n-[2-me thyl-3-(6-{[4-(morpholine-4-carbonyl)phenyl]amino}-9h- purin-2-yl)phenyl]benzamide
4o2p	4O2P
4oli	4OLI
4ot5	Crystal structure of BTK kinase domain complexed with 4-tert-Butyl-N-(3-{8-[4-(4-methyl-piperazine-1-carbonyl)-phenylamino]-imidazo[1,2-a]pyrazin-6-yl}-phenyl)-benzamide
4ot6	Crystal structure of BTK kinase domain complexed with 4-Methanesulfonyl-N-(3-{8-[4-(morpholine-4-carbonyl)-phenylamino]-imidazo[1,2-a]pyrazin-6-yl}-phenyl)-benzamide
4otf	4OTF
4otq	Crystal structure of BTK kinase domain complexed with 1-[5-[3-(7-tert-butyl-4-oxo-quinazolin-3-yl)-2-methyl-phenyl]-1-methyl-2-oxo-3-pyridyl]-3-methyl-urea
4otr	Crystal structure of BTK kinase domain complexed with 6-cyclopropyl-2-[3-[5-[[5-(4-ethylpiperazin-1-yl)-2-pyridyl]amino]-1-methyl-6-oxo-3-pyridyl]-2-(hydroxymethyl)phenyl]-8-fluoro-isoquinolin-1-one
4otw	HER3 pseudokinase domain bound to bosutinib
4p2k	Structure of Ephrin type-A receptor 2
4p4c	4P4C
4p5q	4P5Q
4p5z	4P5Z
4p7e	4P7E
4pdo	Structure of Ephrin type-A receptor 2
4pmm	4PMM
4pmp	4PMP
4pms	4PMS
4pmt	4PMT
4pp9	4PP9
4ppa	4PPA
4ppb	4PPB
4ppc	4PPC
4pqn	4PQN
4puz	Crystal structure of spleen tyrosine kinase (Syk) in complex with GS-9973
4pv0	Crystal structure of spleen tyrosine kinase (Syk) in complex with an imidazopyrazine inhibitor
4px6	SYK catalytic domain in complex with a potent pyridopyrimidinone inhibitor
4py1	4PY1
4q9s	4Q9S
4qd6	4QD6
4qps	4QPS
4qq5	4QQ5
4qqc	4QQC
4qqj	4QQJ
4qqt	4QQT
4qrc	4QRC
4qt1	4QT1
4r1v	4R1V
4r1y	4R1Y
4r3p	4R3P
4r3r	4R3R
4r5s	4R5S
4r6v	4R6V
4r7h	4R7H
4r7i	4R7I
4rfm	4RFM
4rfy	4RFY
4rfz	4RFZ
4rg0	4RG0
4rio	4RIO
4riw	4RIW
4rix	4RIX
4riy	4RIY
4rj4	4RJ4
4rj5	4RJ5
4rj6	4RJ6
4rj7	4RJ7
4rj8	4RJ8
4rss	4RSS
4rt7	4RT7
4rwi	4RWI
4rwj	4RWJ
4rwk	4RWK
4rwl	4RWL
4rx5	4RX5
4rx7	4RX7
4rx8	4RX8
4rx9	4RX9
4tks	4TKS
4trl	4TRL
4tt7	4TT7
4twn	4TWN
4two	4TWO
4twp	4TWP
4tye	4TYE
4tyg	4TYG
4tyi	4TYI
4tyj	4TYJ
4u0i	4U0I
4u5j	4U5J
4ueu	4UEU
4uwb	4UWB
4uwc	4UWC
4uwy	4UWY
4uxl	4UXL
4uxq	4UXQ
4uy9	4UY9
4uya	4UYA
4v01	4V01
4v04	4V04
4v05	4V05
4v0g	4V0G
4wa9	4WA9
4wd5	4WD5
4wkq	4WKQ
4wnm	4WNM
4wrg	4WRG
4wun	4WUN
4x3j	4X3J
4xcu	4XCU
4xey	4XEY
4xg2	4XG2
4xg3	4XG3
4xg4	4XG4
4xg6	4XG6
4xg7	4XG7
4xg8	4XG8
4xg9	4XG9
4xi2	4XI2
4xli	4XLI
4xlv	4XLV
4xmo	4XMO
4xuf	4XUF
4xyf	4XYF
4y93	4Y93
4y95	4Y95
4ybj	4YBJ
4ybk	4YBK
4yc8	4YC8
4yhf	4YHF
4yjo	4YJO
4yjp	4YJP
4yjq	4YJQ
4yjr	4YJR
4yjs	4YJS
4yjt	4YJT
4yju	4YJU
4yjv	4YJV
4ymj	4YMJ
4yne	4YNE
4yps	4YPS
4ytc	4YTC
4ytf	4YTF
4yth	4YTH
4yti	4YTI
4z16	4Z16
4z3v	4Z3V
4z55	4Z55
4zau	4ZAU
4zim	4ZIM
4zjv	4ZJV
4zly	4ZLY
4zlz	4ZLZ
4zog	4ZOG
4zsa	4ZSA
4zse	4ZSE
5a46	5A46
5a4c	5A4C
5a9u	5A9U
5aa8	5AA8
5aa9	5AA9
5aaa	5AAA
5aab	5AAB
5aac	5AAC
5aep	5AEP
5am6	5AM6
5am7	5AM7
5amn	5AMN
5b7v	5B7V
5bmm	5BMM
5bpy	5BPY
5bq0	5BQ0
5bvk	5BVK
5bvn	5BVN
5bvo	5BVO
5bvw	5BVW
5c26	5C26
5c27	5C27
5c8k	5C8K
5c8m	5C8M
5c8n	5C8N
5cal	5CAL
5can	5CAN
5cao	5CAO
5cap	5CAP
5caq	5CAQ
5cas	5CAS
5cau	5CAU
5cav	5CAV
5cf4	5CF4
5cf5	5CF5
5cf6	5CF6
5cf8	5CF8
5cnn	5CNN
5cno	5CNO
5cxh	5CXH
5cxz	5CXZ
5cy3	5CY3
5czh	5CZH
5czi	5CZI
5d10	5D10
5d11	5D11
5d12	5D12
5d41	5D41
5d7v	5D7V
5da3	5DA3
5dg5	5DG5
5e1e	5E1E
5e1s	5E1S
5edp	5EDP
5edq	5EDQ
5edr	5EDR
5eg3	5EG3
5ek7	5EK7
5em5	5EM5
5em6	5EM6
5em7	5EM7
5em8	5EM8
5eob	5EOB
5ew3	5EW3
5ew8	5EW8
5eyc	5EYC
5eyd	5EYD
5f1z	5F1Z
5f20	5F20
5fbn	5FBN
5fbo	5FBO
5fdp	5FDP
5fdx	5FDX
5fed	5FED
5fee	5FEE
5feq	5FEQ
5flf	5FLF
5fto	5FTO
5ftq	5FTQ
5fxq	5FXQ
5fxr	5FXR
5fxs	5FXS
5ghv	5GHV
5hcx	5HCX
5hcy	5HCY
5hcz	5HCZ
5hez	5HEZ
5hg5	5HG5
5hg7	5HG7
5hg8	5HG8
5hg9	5HG9
5hhw	5HHW
5hib	5HIB
5hic	5HIC
5hlw	5HLW
5hni	5HNI
5ho6	5HO6
5hoa	5HOA
5hor	5HOR
5hu9	5HU9
5hx8	5HX8
5hzn	5HZN
5i9u	5I9U
5i9v	5I9V
5i9w	5I9W
5i9x	5I9X
5i9y	5I9Y
5i9z	5I9Z
5ia0	5IA0
5ia1	5IA1
5ia2	5IA2
5ia3	5IA3
5ia4	5IA4
5ia5	5IA5
5imx	5IMX
5iug	5IUG
5iuh	5IUH
5iui	5IUI
5j5s	5J5S
5j7h	5J7H
5j9y	5J9Y
5j9z	5J9Z
5jeb	5JEB
5jkg	5JKG
5jrs	5JRS
5k5x	5K5X
5khw	5KHW
5khx	5KHX
5kup	5KUP
5kz0	5KZ0
5l3a	5L3A
5l6o	5L6O
5l6p	5L6P
5lma	5LMA
5lmb	5LMB
5lwm	5LWM
5lwn	5LWN
5t3q	5T3Q
5t68	5T68
5toz	5TOZ
5tr6	5TR6
5tt7	5TT7

Links (links to other resources describing this domain)

• PFAM: pkinase
• INTERPRO: IPR020635